Alpha-latrotoxin-Lm1a Recombinant Protein | Alpha-LTX-Lm1a recombinant protein
Recombinant Latrodectus mactans Alpha-latrotoxin-Lm1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-latrotoxin-Lm1a; Recombinant Latrodectus mactans Alpha-latrotoxin-Lm1a; Alpha-LTX-Lm1a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-202, Full length protein
Sequence
IVGTIAAAAMTVTHVASGRLNDYILKLEEPNGILLHFKAPLFSIIQEGYAVPKSSLVGTGTSNNEGLLDRNGVDEMLNEKYAVQYASETLFSKDLYNAASNPDSAVGFKLMESPEININERNDWPVASTLLRSSNVNVNLKNSDTPLNLAYFIDQGADINTRNGHLNIVKYLVEEEDLSVDGSKYGIDMTIRTALDIATDLK
Sequence Length
202
Species
Latrodectus mactans (Black widow spider)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
22,054 Da
NCBI Official Full Name
Alpha-latrotoxin-Lm1a
UniProt Protein Name
Alpha-latrotoxin-Lm1a
Protein Family
UniProt Gene Name
Alpha-LTX-Lm1a
UniProt Synonym Gene Names
Alpha-LTX-Lm1a
Uniprot Description
Presynaptic neurotoxin that induces exhaustive neurotransmitter release from vertebrate (but not invertebrate) nerve terminals and endocrine cells. Binds to neurexin-1-alpha (NRXN1), adhesion G protein-coupled receptor L1 (ADGRL1, also known as latrophilin-1), and receptor-type tyrosine-protein phosphatase S (PTPRS), and induces neurotransmitter exocytosis through two calcium-dependent mechanisms (membrane pore formation and signaling via latrophilin) and a yet to be defined calcium-independent mechanism. Induces rapid muscle contracture and loss of twitch tension when added to the isolated and indirectly stimulated chick biventer cervicis nerve-muscle preparation ().
Similar Products
Product Notes
The Alpha-latrotoxin-Lm1a alpha-ltx-lm1a (Catalog #AAA1130180) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-202, Full length protein. The amino acid sequence is listed below: IVGTIAAAAM TVTHVASGRL NDYILKLEEP NGILLHFKAP LFSIIQEGYA VPKSSLVGTG TSNNEGLLDR NGVDEMLNEK YAVQYASETL FSKDLYNAAS NPDSAVGFKL MESPEININE RNDWPVASTL LRSSNVNVNL KNSDTPLNLA YFIDQGADIN TRNGHLNIVK YLVEEEDLSV DGSKYGIDMT IRTALDIATD LK. It is sometimes possible for the material contained within the vial of "Alpha-latrotoxin-Lm1a, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
