Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Aluminum-activated malate transporter 12 (ALMT12) Recombinant Protein | ALMT12 recombinant protein

Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 12 (ALMT12)

Gene Names
ALMT12; aluminum-activated; ATALMT12; malate transporter 12; T6K21.150; T6K21_150
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aluminum-activated malate transporter 12 (ALMT12); Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 12 (ALMT12); Recombinant Aluminum-activated malate transporter 12 (ALMT12); Aluminum-activated malate transporter 12; AtALMT12; Quick anion channel 1; ALMT12 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-560
Sequence
MSNKVHVGSLEMEEGLSKTKWMVLEPSEKIKKIPKRLWNVGKEDPRRVIHALKVGLSLTLVSLLYLMEPLFKGIGSNAIWAVMTVVVVLEFSAGATLCKGLNRGLGTLIAGSLAFFIEFVANDSGKVLRAIFIGTAVFIIGAAATYIRFIPYIKKNYDYGVVIFLLTFNLITVSSYRVDSVINIAHDRFYTIAVGCGICLFMSLLVFPIWSGEDLHKTTVGKLQGLSRSIEACVDEYFEEKEKEKTDSKDRIYEGYQAVLDSKSTDETLALYANWEPRHTLRCHRFPCQQYVKVGAVLRQFGYTVVALHGCLQTEIQTPRSVRALFKDPCVRLAGEVCKALTELADSISNHRHCSPEILSDHLHVALQDLNSAIKSQPKLFLGSNLHRHNNKHQNGSISNNKHHQRNSSNSGKDLNGDVSLQNTETGTRKITETGSRQGQNGAVSLSSFRTDTSALMEYRRSFKNSNSEMSAAGERRMLRPQLSKIAVMTSLEFSEALPFAAFASLLVEMVARLDNVIEEVEELGRIASFKEYDNKRDQTADDVRCENPANVTISVGAAE
Sequence Length
560
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,310 Da
NCBI Official Full Name
aluminum-activated, malate transporter 12
NCBI Official Symbol
ALMT12
NCBI Official Synonym Symbols
aluminum-activated; ATALMT12; malate transporter 12; T6K21.150; T6K21_150
NCBI Protein Information
aluminum-activated, malate transporter 12
UniProt Protein Name
Aluminum-activated malate transporter 12
UniProt Gene Name
ALMT12
UniProt Synonym Gene Names
QUAC1; AtALMT12
UniProt Entry Name
ALMTC_ARATH

NCBI Description

Anion transporter involved in stomatal closure. Gene has 3 splicing variants.

Uniprot Description

Function: Malate-sensitive anion transporter permeable to chloride, nitrate, sulfate and malate. Involved in dark-, CO(2)-, abscisic acid- and water-deficient-induced stomatal closure. Belongs to the R-type anion channels. Ref.4 Ref.5

Subcellular location: Cell membrane; Multi-pass membrane protein. Note: Ref.5 indicates also a not confirmed endomembrane localization. Ref.4 Ref.5

Tissue specificity: Expressed in roots, stems, leaves, flowers and pollen. Mainly detected in the roots vascular stele and in the leaves guard cells. Ref.4 Ref.5

Induction: Not induced by aluminum. Ref.4 Ref.5

Disruption phenotype: Impaired stomatal closure resulting in a wilty phenotype. Ref.4

Miscellaneous: Malate functions as a gating modifier as well as a permeating substrate.

Sequence similarities: Belongs to the aromatic acid exporter (TC 2.A.85) family. [View classification]

Research Articles on ALMT12

Similar Products

Product Notes

The ALMT12 almt12 (Catalog #AAA1245675) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-560. The amino acid sequence is listed below: MSNKVHVGSL EMEEGLSKTK WMVLEPSEKI KKIPKRLWNV GKEDPRRVIH ALKVGLSLTL VSLLYLMEPL FKGIGSNAIW AVMTVVVVLE FSAGATLCKG LNRGLGTLIA GSLAFFIEFV ANDSGKVLRA IFIGTAVFII GAAATYIRFI PYIKKNYDYG VVIFLLTFNL ITVSSYRVDS VINIAHDRFY TIAVGCGICL FMSLLVFPIW SGEDLHKTTV GKLQGLSRSI EACVDEYFEE KEKEKTDSKD RIYEGYQAVL DSKSTDETLA LYANWEPRHT LRCHRFPCQQ YVKVGAVLRQ FGYTVVALHG CLQTEIQTPR SVRALFKDPC VRLAGEVCKA LTELADSISN HRHCSPEILS DHLHVALQDL NSAIKSQPKL FLGSNLHRHN NKHQNGSISN NKHHQRNSSN SGKDLNGDVS LQNTETGTRK ITETGSRQGQ NGAVSLSSFR TDTSALMEYR RSFKNSNSEM SAAGERRMLR PQLSKIAVMT SLEFSEALPF AAFASLLVEM VARLDNVIEE VEELGRIASF KEYDNKRDQT ADDVRCENPA NVTISVGAAE. It is sometimes possible for the material contained within the vial of "Aluminum-activated malate transporter 12 (ALMT12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.