DNA/RNA-binding protein Alba 1 (albA1) Recombinant Protein | albA1 recombinant protein

Recombinant Sulfolobus solfataricus DNA/RNA-binding protein Alba 1 (albA1)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

DNA/RNA-binding protein Alba 1 (albA1); Recombinant Sulfolobus solfataricus DNA/RNA-binding protein Alba 1 (albA1); albA1 recombinant protein

Ordering
Cat. Num. AAA1193668 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

2-97, Full length protein

Sequence

SSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK

Sequence Length

Species

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

497678222

NCBI Accession #

WP_009992406.1

NCBI GenBank Nucleotide #

WP_009992406.1

UniProt Accession #

P60849; P74761; Q97ZF6

Molecular Weight

10,585 Da

NCBI Official Full Name

MULTISPECIES: DNA-binding protein

UniProt Protein Name

DNA/RNA-binding protein Alba 1

Protein Family

DNA/RNA-binding protein

UniProt Gene Name

albA1

UniProt Synonym Gene Names

sso10b

Uniprot Description

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. May be involved in DNA compaction. May bind rRNA and mRNA, playing a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Similar Products

Product Notes

The albA1 alba1 (Catalog #AAA1193668) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-97, Full length protein. The amino acid sequence is listed below: SSGTPTPSNV VLIGKKPVMN YVLAALTLLN QGVSEIVIKA RGRAISKAVD TVEIVRNRFL PDKIEIKEIR VGSQVVTSQD GRQSRVSTIE IAIRKK. It is sometimes possible for the material contained within the vial of "DNA/RNA-binding protein Alba 1 (albA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...