Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Aldo-keto reductase family 1 member C3 (AKR1C3) Recombinant Protein | AKR1C3 recombinant protein

Recombinant Human Aldo-keto reductase family 1 member C3 (AKR1C3)

Gene Names
AKR1C3; DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aldo-keto reductase family 1 member C3 (AKR1C3); Recombinant Human Aldo-keto reductase family 1 member C3 (AKR1C3); Aldo-keto reductase family 1 member C3; EC=1.-.-.-; 17-beta-hydroxysteroid dehydrogenase type 5; 17-beta-HSD 5; 3-alpha-HSD type II; brain; 3-alpha-hydroxysteroid dehydrogenase type 2; 3-alpha-HSD type 2; EC=1.1.1.213; Chlordecone reductase homolog HAKRb;; AKR1C3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-323aa; Full Length
Sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Sequence Length
323
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for AKR1C3 recombinant protein
Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone.
Product Categories/Family for AKR1C3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63.9 kDa
NCBI Official Full Name
aldo-keto reductase family 1 member C3 isoform 2
NCBI Official Synonym Full Names
aldo-keto reductase family 1, member C3
NCBI Official Symbol
AKR1C3
NCBI Official Synonym Symbols
DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS
NCBI Protein Information
aldo-keto reductase family 1 member C3; indanol dehydrogenase; prostaglandin F synthase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; dihydrodiol dehydrogenase X; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; 3-alpha hydroxysteroid dehydrogenase, type II; type IIb 3-alpha hydroxysteroid dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
UniProt Protein Name
Aldo-keto reductase family 1 member C3
UniProt Gene Name
AKR1C3
UniProt Synonym Gene Names
DDH1; HSD17B5; KIAA0119; PGFS; 17-beta-HSD 5; 3-alpha-HSD type 2; DD-3; DD3; PGFS
UniProt Entry Name
AK1C3_HUMAN

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

AKR1C3: Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta- PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone. Belongs to the aldo/keto reductase family.

Protein type: Xenobiotic Metabolism - metabolism by cytochrome P450; Lipid Metabolism - arachidonic acid; EC 1.1.1.149; Oxidoreductase

Chromosomal Location of Human Ortholog: 10p15-p14

Cellular Component: cytoplasm; intracellular; cytosol; nucleus

Molecular Function: 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity; delta4-3-oxosteroid 5beta-reductase activity; aldo-keto reductase activity; prostaglandin-F synthase activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity; phenanthrene 9,10-monooxygenase activity; retinol dehydrogenase activity; 3(or 17)-alpha-hydroxysteroid dehydrogenase activity; oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; ketosteroid monooxygenase activity; testosterone 17-beta-dehydrogenase (NADP+) activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity; ketoreductase activity; indanol dehydrogenase activity; aldehyde reductase activity; geranylgeranyl reductase activity; retinal dehydrogenase activity

Biological Process: steroid metabolic process; phototransduction, visible light; retinal metabolic process; cyclooxygenase pathway; male gonad development; progesterone metabolic process; cellular response to starvation; prostaglandin metabolic process; keratinocyte differentiation; positive regulation of protein kinase B signaling cascade; G-protein coupled receptor protein signaling pathway; protein import into nucleus, translocation; positive regulation of cell proliferation; arachidonic acid metabolic process; multicellular organismal macromolecule metabolic process; farnesol catabolic process; retinoid metabolic process; response to nutrient; regulation of retinoic acid receptor signaling pathway

Research Articles on AKR1C3

Similar Products

Product Notes

The AKR1C3 akr1c3 (Catalog #AAA968241) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-323aa; Full Length. The amino acid sequence is listed below: MDSKHQCVKL NDGHFMPVLG FGTYAPPEVP RSKALEVTKL AIEAGFRHID SAHLYNNEEQ VGLAIRSKIA DGSVKREDIF YTSKLWSTFH RPELVRPALE NSLKKAQLDY VDLYLIHSPM SLKPGEELSP TDENGKVIFD IVDLCTTWEA MEKCKDAGLA KSIGVSNFNR RQLEMILNKP GLKYKPVCNQ VECHPYFNRS KLLDFCKSKD IVLVAYSALG SQRDKRWVDP NSPVLLEDPV LCALAKKHKR TPALIALRYQ LQRGVVVLAK SYNEQRIRQN VQVFEFQLTA EDMKAIDGLD RNLHYFNSDS FASHPNYPYS DEY. It is sometimes possible for the material contained within the vial of "Aldo-keto reductase family 1 member C3 (AKR1C3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.