Adenylate kinase isoenzyme 1 (Ak1) Recombinant Protein | Ak1 recombinant protein
Recombinant Mouse Adenylate kinase isoenzyme 1 (Ak1)
Gene Names
Ak1; Ak-1; B430205N08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenylate kinase isoenzyme 1 (Ak1); Recombinant Mouse Adenylate kinase isoenzyme 1 (Ak1); Ak1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194, full length protein
Sequence
MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK
Sequence Length
194
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ak1 recombinant protein
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,116 Da
NCBI Official Full Name
adenylate kinase isoenzyme 1 isoform 2
NCBI Official Synonym Full Names
adenylate kinase 1
NCBI Official Symbol
Ak1
NCBI Official Synonym Symbols
Ak-1; B430205N08Rik
NCBI Protein Information
adenylate kinase isoenzyme 1
UniProt Protein Name
Adenylate kinase isoenzyme 1
Protein Family
UniProt Gene Name
Ak1
UniProt Synonym Gene Names
AK 1
Uniprot Description
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also possesses broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism (). May provide a mechanism to buffer the adenylate energy charge for sperm motility.
Research Articles on Ak1
Similar Products
Product Notes
The Ak1 ak1 (Catalog #AAA1414462) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194, full length protein. The amino acid sequence is listed below: MEEKLKKAKI IFVVGGPGSG KGTQCEKIVQ KYGYTHLSTG DLLRAEVSSG SERGKKLSAI MEKGELVPLD TVLDMLRDAM LAKVDSSNGF LIDGYPREVK QGEEFEQKIG QPTLLLYVDA GAETMTQRLL KRGETSGRVD DNEETIKKRL ETYYNATEPV ISFYDKRGIV RKVNAEGTVD TVFSEVCTYL DSLK. It is sometimes possible for the material contained within the vial of "Adenylate kinase isoenzyme 1 (Ak1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
