DEAD-box ATP-dependent RNA helicase 56 (Os01g0549700, LOC_Os01g36890) Recombinant Protein | Os01g0549700 recombinant protein
Recombinant Oryza sativa subsp. japonica DEAD-box ATP-dependent RNA helicase 56 (Os01g0549700, LOC_Os01g36890)
Gene Names
LOC4326192; BAT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DEAD-box ATP-dependent RNA helicase 56 (Os01g0549700; LOC_Os01g36890); Recombinant Oryza sativa subsp. japonica DEAD-box ATP-dependent RNA helicase 56 (Os01g0549700; Os01g0549700 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-432, Full length protein
Sequence
MAEAEVKDNEVYEEDLVDYEEEVENGTDGGANAANASADVVKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPGRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS
Sequence Length
432
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,062 Da
NCBI Official Full Name
DEAD-box ATP-dependent RNA helicase 56 isoform X1
NCBI Official Symbol
LOC4326192
NCBI Official Synonym Symbols
BAT1
NCBI Protein Information
DEAD-box ATP-dependent RNA helicase 15; DEAD-box ATP-dependent RNA helicase 56
UniProt Protein Name
DEAD-box ATP-dependent RNA helicase 56
UniProt Gene Name
AIP1
Uniprot Description
ATP-binding RNA helicase involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus (). Required for tapetal programmed cell death (PCD) and degeneration during anther development. Forms dimer with AIP2 and binds the promoter region of the cysteine protease CP1. Can complement the yeast RNA helicase SUB2. Plants silencing AIP1 and AIP2 are male sterile (PubMed:21467577).
Research Articles on Os01g0549700
Similar Products
Product Notes
The Os01g0549700 aip1 (Catalog #AAA1315197) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-432, Full length protein. The amino acid sequence is listed below: MAEAEVKDNE VYEEDLVDYE EEVENGTDGG ANAANASADV VKKGYVGIHS SGFRDFLLKP ELLRAIQDCG FEHPSEVQHE CIPQAILGMD VICQAKSGMG KTAVFVLSSL QQIDPVAGQV GALVLCHTRE LAYQICHEFE RFSKYLPEVK VAVFYGGVHI KKHKDLLKND CPHIVVGTPG RILALAREKD LSLKNVRHFI LDECDKMLDS LDMRRDVQEI FKMTPHDKQV MMFSATLSKE IRPVCKKFMQ DPMEIYVDDE AKLTLHGLVQ HYIKLSEAEK NRKLNDLLDA LDFNQVVIFV KSVSRAAELN KLLCECNFPA ISIHSGMTQE ERLTRYKNFK EGHKRILVAT DLVGRGIDIE RVNIVINYDM PDSADSYLHR VGRAGRFGTK GLAITFVSSA SDSDVLNQVQ ERFEVDIKEL PEQIDTSTYM PS. It is sometimes possible for the material contained within the vial of "DEAD-box ATP-dependent RNA helicase 56 (Os01g0549700, LOC_Os01g36890), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
