Altered inheritance of mitochondria protein 43, mitochondrial (AIM43) Recombinant Protein | ZYRO0F14828g recombinant protein
Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Altered inheritance of mitochondria protein 43; mitochondrial (AIM43); Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 43; Recombinant Altered inheritance of mitochondria protein 43; mitochondrial; Found in mitochondrial proteome protein 14; ZYRO0F14828g recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-176
Sequence
YCPLKSSQGTDIKSLEDLTKLKSLEGVDPELIRKLINERTIELNVQNELEMLKNLNKQEKMSQEVSLKRFVRPLWVFFLMSSTVYLILHYVWWKLEVVEKEKELQSHVESLEMELDQTLKSQNQNVSSSQNNGNNKTNDKPWYRKWFF
Sequence Length
176
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,746 Da
NCBI Official Full Name
ZYRO0F14828p
NCBI Official Symbol
ZYRO0F14828g
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Altered inheritance of mitochondria protein 43, mitochondrial
UniProt Gene Name
AIM43
UniProt Synonym Gene Names
FMP14
UniProt Entry Name
AIM43_ZYGRC
Uniprot Description
Subcellular location: Mitochondrion membrane; Single-pass membrane protein
By similarity.
Sequence similarities: Belongs to the AIM43 family.
Similar Products
Product Notes
The ZYRO0F14828g aim43 (Catalog #AAA1242246) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-176. The amino acid sequence is listed below: YCPLKSSQGT DIKSLEDLTK LKSLEGVDPE LIRKLINERT IELNVQNELE MLKNLNKQEK MSQEVSLKRF VRPLWVFFLM SSTVYLILHY VWWKLEVVEK EKELQSHVES LEMELDQTLK SQNQNVSSSQ NNGNNKTNDK PWYRKWFF. It is sometimes possible for the material contained within the vial of "Altered inheritance of mitochondria protein 43, mitochondrial (AIM43), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
