ER membrane protein complex subunit 3 (AIM27) Recombinant Protein | AIM27 recombinant protein
Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ER membrane protein complex subunit 3 (AIM27); Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3 (AIM27); Recombinant ER membrane protein complex subunit 3 (AIM27); ER membrane protein complex subunit 3; Altered inheritance rate of mitochondria protein 27; AIM27 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-253
Sequence
MLLDDQLKYWVLLPISIVMVLTGVLKQYIMTLITGSSANEAQPRVKLTEWQYLQWAQLLIGNGGNLSSDAFAAKKEFLVKDLTEERHLAKAKQQDGSQAGEVPNPFNDPSMSNAMMNMAKGNMASFIPQTIIMWWVNHFFAGFILMQLPFPLTAKFKEMLQTGIICQDLDVRWVSSISWYFISVLGLNPVYNLIGLNDQDMGIQAGIGGPQGPQGPPQSQVDKAMHAMANDLTIIQHETCLDNVEQRVLKQYM
Sequence Length
253
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
28,352 Da
UniProt Protein Name
ER membrane protein complex subunit 3
UniProt Gene Name
AIM27
UniProt Synonym Gene Names
EMC3
UniProt Entry Name
EMC3_YEAS7
Uniprot Description
Function: The EMC seems to be required for efficient folding of proteins in the endoplasmic reticulum (ER)
By similarity.
Subunit structure: Component of the ER membrane protein complex (EMC), which is composed of EMC1, EMC2, EMC3, EMC4, EMC5 and EMC6
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the EMC3 family.
Sequence caution: The sequence EDN59821.1 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The ER membrane protein complex subunit 3 (AIM27) aim27 (Catalog #AAA1213905) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-253. The amino acid sequence is listed below: MLLDDQLKYW VLLPISIVMV LTGVLKQYIM TLITGSSANE AQPRVKLTEW QYLQWAQLLI GNGGNLSSDA FAAKKEFLVK DLTEERHLAK AKQQDGSQAG EVPNPFNDPS MSNAMMNMAK GNMASFIPQT IIMWWVNHFF AGFILMQLPF PLTAKFKEML QTGIICQDLD VRWVSSISWY FISVLGLNPV YNLIGLNDQD MGIQAGIGGP QGPQGPPQSQ VDKAMHAMAN DLTIIQHETC LDNVEQRVLK QYM. It is sometimes possible for the material contained within the vial of "ER membrane protein complex subunit 3 (AIM27), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
