Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Alpha-hemoglobin-stabilizing protein (Ahsp) Recombinant Protein | Ahsp recombinant protein

Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)

Gene Names
Ahsp; EDRF; Eraf
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-hemoglobin-stabilizing protein (Ahsp); Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp); Ahsp recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-102, full length protein
Sequence
MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLPSS
Sequence Length
102
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,832 Da
NCBI Official Full Name
alpha-hemoglobin-stabilizing protein
NCBI Official Synonym Full Names
alpha hemoglobin stabilizing protein
NCBI Official Symbol
Ahsp
NCBI Official Synonym Symbols
EDRF; Eraf
NCBI Protein Information
alpha-hemoglobin-stabilizing protein
UniProt Protein Name
Alpha-hemoglobin-stabilizing protein
Protein Family
UniProt Gene Name
Ahsp
UniProt Synonym Gene Names
Edrf; Eraf

Uniprot Description

Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation.

Research Articles on Ahsp

1. role of alpha-hemoglobin stabilizing protein in hemoglobin assembly

Similar Products

Ahsp ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

aHSP Antibody

Host: Mouse
Reactivity: Mouse
Apps: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation

aHSP ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

aHSP Antibody

Host: Rabbit
Reactivity: Mouse
Apps: Western Blot, Immunocytochemistry, Immunohistochemistry, ELISA

AHSP Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a

Product Notes

The Ahsp ahsp (Catalog #AAA1444904) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-102, full length protein. The amino acid sequence is listed below: MAPFQSNKDL ISTGIKEFNV LLDQQVFDDP LISEEDMVIV VHDWVNLYTN YYKKLVHGEQ EEQDRAMTEF QQELSTLGSQ FLAKYRTFLK SKEPPSNTLP SS. It is sometimes possible for the material contained within the vial of "Alpha-hemoglobin-stabilizing protein (Ahsp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
contact@aaabiotech.com
Looking for a specific manual?
Request a Manual