Peroxiredoxin type-2 (AHP1) Recombinant Protein | AHP1 recombinant protein
Recombinant Saccharomyces cerevisiae Peroxiredoxin type-2 (AHP1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxiredoxin type-2 (AHP1); Recombinant Saccharomyces cerevisiae Peroxiredoxin type-2 (AHP1); AHP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-176, full length protein
Sequence
SDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Sequence Length
175
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,115 Da
NCBI Official Full Name
thioredoxin peroxidase AHP1
NCBI Official Symbol
AHP1
NCBI Protein Information
thioredoxin peroxidase AHP1
UniProt Protein Name
Peroxiredoxin AHP1
Protein Family
UniProt Gene Name
AHP1
UniProt Synonym Gene Names
TPx type II
Uniprot Description
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Preferentially eliminates organic peroxides rather than hydrogen peroxide (PubMed:10391912, PubMed:9988687, PubMed:10681558). Relays alkyl hydroperoxides as a signal to the transcription factor CAD1/YAP2 by inducing the formation of intramolecular disulfide bonds in CAD1, which causes its nuclear accumulation and activation (PubMed:20145245). Involved in cellular Mn2+ homeostasis (PubMed:10635552).
Research Articles on AHP1
Similar Products
Product Notes
The AHP1 ahp1 (Catalog #AAA1169350) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-176, full length protein. The amino acid sequence is listed below: SDLVNKKFPA GDYKFQYIAI SQSDADSESC KMPQTVEWSK LISENKKVII TGAPAAFSPT CTVSHIPGYI NYLDELVKEK EVDQVIVVTV DNPFANQAWA KSLGVKDTTH IKFASDPGCA FTKSIGFELA VGDGVYWSGR WAMVVENGIV TYAAKETNPG TDVTVSSVES VLAHL. It is sometimes possible for the material contained within the vial of "Peroxiredoxin type-2 (AHP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
