Solute carrier family 25 member 38 homolog Recombinant Protein | AGOS_AGR383W recombinant protein
Recombinant Ashbya gossypii Solute carrier family 25 member 38 homolog (AGR383W)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Solute carrier family 25 member 38 homolog; Recombinant Ashbya gossypii Solute carrier family 25 member 38 homolog (AGR383W); AGOS_AGR383W recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-293aa; full length protein
Sequence
MSEKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRG TLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY EQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQL QSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLLH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for AGOS_AGR383W recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,817 Da
NCBI Official Full Name
AGR383Wp
NCBI Official Symbol
AGOS_AGR383W
NCBI Protein Information
AGR383Wp
UniProt Protein Name
Solute carrier family 25 member 38 homolog
Protein Family
UniProt Gene Name
AGR383W
UniProt Entry Name
S2538_ASHGO
Uniprot Description
Mitochondrial carrier required for the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.
Similar Products
Product Notes
The AGOS_AGR383W agr383w (Catalog #AAA7036509) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-293aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the AGOS_AGR383W agr383w for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEKAGGVPA HLVSGFFGGL ASVCALQPLD LLKTRLQQAQ ASSLRSVLRE VRTTRELWRG TLPSALRTSI GSALYLSLLN YSRSALARGS EARTRSSLLP RLQSYQNLLT GALSRAAVGL VTMPITVIKV RYESTLYAYN GLAEATRHIW RSEGARGFFK GAAATTLRDA PYAGLYVLLY EQAKEMLPRA LPATLLGADE SGKLTAPASA MVNGVSAFLS ASLATTLTAP FDTIKTRMQL QSHPVGFVQT LRHIVCEERA RTLFDGLSLR LCRKAMSACI AWGIYEELLK LLH. It is sometimes possible for the material contained within the vial of "Solute carrier family 25 member 38 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
