Glycerol-3-phosphate acyltransferase 4 (AGPAT6) Recombinant Protein | AGPAT6 recombinant protein
Recombinant Bovine Glycerol-3-phosphate acyltransferase 4 (AGPAT6)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycerol-3-phosphate acyltransferase 4 (AGPAT6); Recombinant Bovine Glycerol-3-phosphate acyltransferase 4 (AGPAT6); Recombinant Glycerol-3-phosphate acyltransferase 4 (AGPAT6); Glycerol-3-phosphate acyltransferase 4; GPAT4 EC= 2.3.1.15; 1-acylglycerol-3-phosphate O-acyltransferase 6; 1-AGP acyltransferase 6; 1-AGPAT 6 Acyl-CoA:glycerol-3-phosphate acyltransferase 4 Lys; AGPAT6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
38-456
Sequence
VSFGIRKLYMKTLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCLLLSLRIALAFTGISLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHDRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVARRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQAEEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS
Sequence Length
456
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,055 Da
NCBI Official Full Name
glycerol-3-phosphate acyltransferase 6
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta)<
NCBI Official Symbol
AGPAT6
NCBI Protein Information
glycerol-3-phosphate acyltransferase 6; GPAT4; 1-AGPAT 6; LPAAT-zeta; 1-AGP acyltransferase 6; glycerol-3-phosphate acyltransferase 4; lysophosphatidic acid acyltransferase zeta; acyl-CoA:glycerol-3-phosphate acyltransferase 4
UniProt Protein Name
Glycerol-3-phosphate acyltransferase 4
UniProt Gene Name
AGPAT6
UniProt Synonym Gene Names
GPAT4; GPAT4; 1-AGP acyltransferase 6; 1-AGPAT 6; LPAAT-zeta
UniProt Entry Name
GPAT4_BOVIN
Uniprot Description
Function: Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis. Active against both saturated and unsaturated long-chain fatty acyl-CoAs
By similarity.
Catalytic activity: Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1-acyl-sn-glycerol 3-phosphate.
Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity.
Domain: The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate
By similarity.
Sequence similarities: Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Research Articles on AGPAT6
Similar Products
Product Notes
The AGPAT6 agpat6 (Catalog #AAA1134765) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-456. The amino acid sequence is listed below: VSFGIRKLYM KTLLKIFAWA TLRMERGAKE KNHQLYKPYT NGIIAKDPTS LEEEIKEIRR SGSSKALDNT PEFELSDIFY FCRKGMETIM DDEVTKRFSA EELESWNLLS RTNYNFQYIS LRLTVLWGLG VLIRYCLLLS LRIALAFTGI SLLVVGTTMV GYLPNGRFKE FLSKHVHLMC YRICVRALTA IITYHDRKNR PRNGGICVAN HTSPIDVIIL ASDGYYAMVG QVHGGLMGVI QRAMVKACPH VWFERSEVKD RHLVARRLTE HVQDKSKLPI LIFPEGTCIN NTSVMMFKKG SFEIGATVYP VAIKYDPQFG DAFWNSSKYG MVTYLLRMMT SWAIVCSVWY LPPMTRQAEE DAVQFANRVK SAIARQGGLV DLLWDGGLKR EKVKDTFKEE QQKLYSKMIV GNHEDRSRS. It is sometimes possible for the material contained within the vial of "Glycerol-3-phosphate acyltransferase 4 (AGPAT6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
