Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4) Recombinant Protein | AGPAT4 recombinant protein

Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4)

Gene Names
AGPAT4; 1-AGPAT4; dJ473J16.2; LPAAT-delta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4); Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4); AGPAT4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-378aa; Full Length of Mature Protein
Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for AGPAT4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,951 Da
NCBI Official Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase delta
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 4
NCBI Official Symbol
AGPAT4
NCBI Official Synonym Symbols
1-AGPAT4; dJ473J16.2; LPAAT-delta
NCBI Protein Information
1-acyl-sn-glycerol-3-phosphate acyltransferase delta
UniProt Protein Name
1-acyl-sn-glycerol-3-phosphate acyltransferase delta
UniProt Gene Name
AGPAT4
UniProt Synonym Gene Names
1-AGP acyltransferase 4; 1-AGPAT 4; LPAAT-delta
UniProt Entry Name
PLCD_HUMAN

NCBI Description

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq, Jul 2008]

Uniprot Description

AGPAT4: Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Lipid Metabolism - glycerophospholipid; Transferase; EC 2.3.1.51; Lipid Metabolism - glycerolipid; Lipid Metabolism - ether lipid

Chromosomal Location of Human Ortholog: 6q26

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity; protein binding

Biological Process: CDP-diacylglycerol biosynthetic process; phosphatidic acid biosynthetic process; phospholipid biosynthetic process; triacylglycerol biosynthetic process

Research Articles on AGPAT4

Similar Products

Product Notes

The AGPAT4 agpat4 (Catalog #AAA7007396) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-378aa; Full Length of Mature Protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the AGPAT4 agpat4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDLAGLLKSQ FLCHLVFCYV FIASGLIINT IQLFTLLLWP INKQLFRKIN CRLSYCISSQ LVMLLEWWSG TECTIFTDPR AYLKYGKENA IVVLNHKFEI DFLCGWSLSE RFGLLGGSKV LAKKELAYVP IIGWMWYFTE MVFCSRKWEQ DRKTVATSLQ HLRDYPEKYF FLIHCEGTRF TEKKHEISMQ VARAKGLPRL KHHLLPRTKG FAITVRSLRN VVSAVYDCTL NFRNNENPTL LGVLNGKKYH ADLYVRRIPL EDIPEDDDEC SAWLHKLYQE KDAFQEEYYR TGTFPETPMV PPRRPWTLVN WLFWASLVLY PFFQFLVSMI RSGSSLTLAS FILVFFVASV GVRWMIGVTE IDKGSAYGNS DSKQKLND . It is sometimes possible for the material contained within the vial of "1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.