Arf-GAP domain and FG repeat-containing protein 2 (AGFG2) Recombinant Protein | AGFG2 recombinant protein
Recombinant Human Arf-GAP domain and FG repeat-containing protein 2 (AGFG2)
Gene Names
AGFG2; HRBL; RABR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arf-GAP domain and FG repeat-containing protein 2 (AGFG2); Recombinant Human Arf-GAP domain and FG repeat-containing protein 2 (AGFG2); AGFG2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-481, Full length protein
Sequence
MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPAGQASFQAQPTPAGSSQGTPFGATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMGGGGGSSTGLAFGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTNPFL
Sequence Length
481
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AGFG2 recombinant protein
This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. The 3 UTR of this gene contains an insulin receptor substrate 3-like pseudogene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,344 Da
NCBI Official Full Name
arf-GAP domain and FG repeat-containing protein 2
NCBI Official Synonym Full Names
ArfGAP with FG repeats 2
NCBI Official Symbol
AGFG2
NCBI Official Synonym Symbols
HRBL; RABR
NCBI Protein Information
arf-GAP domain and FG repeat-containing protein 2
UniProt Protein Name
Arf-GAP domain and FG repeat-containing protein 2
Protein Family
UniProt Gene Name
AGFG2
UniProt Synonym Gene Names
HRBL; RABR; RAB-R
NCBI Description
This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Feb 2013]
Similar Products
Product Notes
The AGFG2 agfg2 (Catalog #AAA1035157) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-481, Full length protein. The amino acid sequence is listed below: MVMAAKKGPG PGGGVSGGKA EAEAASEVWC RRVRELGGCS QAGNRHCFEC AQRGVTYVDI TVGSFVCTTC SGLLRGLNPP HRVKSISMTT FTEPEVVFLQ SRGNEVCRKI WLGLFDARTS LVPDSRDPQK VKEFLQEKYE KKRWYVPPDQ VKGPTYTKGS ASTPVQGSIP EGKPLRTLLG DPAPSLSVAA STSSQPVSQS HARTSQARST QPPPHSSVKK ASTDLLADIG GDPFAAPQMA PAFAAFPAFG GQTPSQGGFA NFDAFSSGPS SSVFGSLPPA GQASFQAQPT PAGSSQGTPF GATPLAPASQ PNSLADVGSF LGPGVPAAGV PSSLFGMAGQ VPPLQSVTMG GGGGSSTGLA FGAFTNPFTA PAAQSPLPST NPFQPNGLAP GPGFGMSSAG PGFPQAVPPT GAFASSFPAP LFPPQTPLVQ QQNGSSFGDL GSAKLGQRPL SQPAGISTNP FMTGPSSSPF ASKPPTTNPF L. It is sometimes possible for the material contained within the vial of "Arf-GAP domain and FG repeat-containing protein 2 (AGFG2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
