Cytosolic carboxypeptidase 2 (AGBL2) Recombinant Protein | AGBL2 recombinant protein
Recombinant Human Cytosolic carboxypeptidase 2 (AGBL2) , partial
Gene Names
AGBL2; CCP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytosolic carboxypeptidase 2 (AGBL2); Recombinant Human Cytosolic carboxypeptidase 2 (AGBL2); partial; AGBL2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
55-190. Partial.
Sequence
LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE
Sequence Length
190
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,454 Da
NCBI Official Full Name
cytosolic carboxypeptidase 2
NCBI Official Synonym Full Names
ATP/GTP binding protein like 2
NCBI Official Symbol
AGBL2
NCBI Official Synonym Symbols
CCP2
NCBI Protein Information
cytosolic carboxypeptidase 2
UniProt Protein Name
Cytosolic carboxypeptidase 2
Protein Family
UniProt Gene Name
AGBL2
UniProt Synonym Gene Names
CCP2
Uniprot Description
Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Does not show detyrosinase or deglycylase activities from the carboxy-terminus of tubulin.
Research Articles on AGBL2
Similar Products
Product Notes
The AGBL2 agbl2 (Catalog #AAA1441338) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 55-190. Partial. The amino acid sequence is listed below: LLNGSLGEKD DLIPDTLQKE KLLWPISLSS AVHRQIEAIN RDFHSCLGWM QWRGLSSLQP PPPRFKDSPA SAFRVAGITD SHMLSLPHLR SRQLLYDELD EVNPRLREPQ ELFSILSTKR PLQAPRWPIE CEVIKE . It is sometimes possible for the material contained within the vial of "Cytosolic carboxypeptidase 2 (AGBL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
