Putative N-acetylgalactosamine permease IIC component 2 (agaW) Recombinant Protein | agaW recombinant protein
Recombinant Escherichia coli Putative N-acetylgalactosamine permease IIC component 2 (agaW)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative N-acetylgalactosamine permease IIC component 2 (agaW); Recombinant Escherichia coli Putative N-acetylgalactosamine permease IIC component 2 (agaW); Recombinant Putative N-acetylgalactosamine permease IIC component 2 (agaW); Putative N-acetylgalactosamine permease IIC component 2; EIIC-Aga' PTS system N-acetylgalactosamine-specific EIIC component 2; agaW recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-133
Sequence
MEISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAGAQPPNVIIGTIVGTAFAITTGVKPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDLATNPRRI
Sequence Length
133
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
13,721 Da
NCBI Official Full Name
Putative N-acetylgalactosamine permease IIC component 2
UniProt Protein Name
Putative N-acetylgalactosamine permease IIC component 2
Protein Family
UniProt Gene Name
agaW
UniProt Entry Name
PTPC2_ECOLI
Uniprot Description
Function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. This system is involved in N-acetylgalactosamine transport.
Subcellular location: Cell inner membrane; Multi-pass membrane protein. Note: When overexpressed.
Domain: The EIIC domain forms the PTS system translocation channel and contains the specific substrate-binding site.
Sequence similarities: Contains 1 PTS EIIC type-4 domain.
Caution: Could be the product of a pseudogene.
Similar Products
Product Notes
The Putative N-acetylgalactosamine permease IIC component 2 (agaW) agaw (Catalog #AAA1262261) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-133. The amino acid sequence is listed below: MEISLLQAFA LGIIAFIAGL DMFNGLTHMH RPVVLGPLVG LVLGDLHTGI LTGGTLELVW MGLAPLAGAQ PPNVIIGTIV GTAFAITTGV KPDVAVGVAV PFAVAVQMGI TFLFSVMSGV MSRCDLATNP RRI. It is sometimes possible for the material contained within the vial of "Putative N-acetylgalactosamine permease IIC component 2 (agaW), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
