Arogenate dehydratase 5, chloroplastic (ADT5) Recombinant Protein | ADT5 recombinant protein
Recombinant Arabidopsis thaliana Arogenate dehydratase 5, chloroplastic (ADT5)
Gene Names
ADT5; arogenate dehydratase 5; MDJ22.5; MDJ22_5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arogenate dehydratase 5; chloroplastic (ADT5); Recombinant Arabidopsis thaliana Arogenate dehydratase 5; ADT5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-425, Full length protein
Sequence
CSYRSESFSFPNGVGSSRADWQSSCAILASKVVSAENSSSVAVVNGHSNGSVDLSLVPSKSQHNGKPGLIQPLTITDLSPAPSHGSTLRVAYQGVPGAYSEAAAGKAYPNSEAIPCDQFDVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCITRVISHPQALAQTEGSLNKLTPKAAIEAFHDTAAAAEYIAANNLHDTAAVASARAAELYGLQILADGIQDDAGNVTRFLMLARDPIIPRTDRPFKTSIVFAAQEHKGTSVLFKVLSAFAFRNISLTKIESRPHQNCPVRVVGDENVGTSKHFEYTFYVDFEASMAEARAQNALAEVQEYTSFLRVLGSYPMDMTPWSTLPSEDV
Sequence Length
387
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,928 Da
NCBI Official Full Name
arogenate dehydratase 5
NCBI Official Symbol
ADT5
NCBI Official Synonym Symbols
arogenate dehydratase 5; MDJ22.5; MDJ22_5
NCBI Protein Information
arogenate dehydratase 5
UniProt Protein Name
Arogenate dehydratase 5, chloroplastic
Protein Family
UniProt Gene Name
ADT5
UniProt Synonym Gene Names
AtADT5
NCBI Description
Encodes a plastid-localized arogenate dehydratase involved in phenylalanine biosynthesis. Not less than six genes encoding ADT were identified in the Arabidopsis genome: ADT1 [At1g11790]; ADT2 [At3g07630]; ADT3 [At2g27820]; ADT4 [At3g44720]; ADT5 [At5g22630]; and ADT6 [At1g08250].
Uniprot Description
Converts the prephenate produced from the shikimate-chorismate pathway into phenylalanine.
Similar Products
Product Notes
The ADT5 adt5 (Catalog #AAA1475476) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-425, Full length protein. The amino acid sequence is listed below: CSYRSESFSF PNGVGSSRAD WQSSCAILAS KVVSAENSSS VAVVNGHSNG SVDLSLVPSK SQHNGKPGLI QPLTITDLSP APSHGSTLRV AYQGVPGAYS EAAAGKAYPN SEAIPCDQFD VAFQAVELWI ADRAVLPVEN SLGGSIHRNY DLLLRHRLHI VGEVQIPVHH CLLALPGVRT DCITRVISHP QALAQTEGSL NKLTPKAAIE AFHDTAAAAE YIAANNLHDT AAVASARAAE LYGLQILADG IQDDAGNVTR FLMLARDPII PRTDRPFKTS IVFAAQEHKG TSVLFKVLSA FAFRNISLTK IESRPHQNCP VRVVGDENVG TSKHFEYTFY VDFEASMAEA RAQNALAEVQ EYTSFLRVLG SYPMDMTPWS TLPSEDV. It is sometimes possible for the material contained within the vial of "Arogenate dehydratase 5, chloroplastic (ADT5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
