Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Adenosine receptor A2b (ADORA2B) Recombinant Protein | ADORA2B recombinant protein

Recombinant Human Adenosine receptor A2b (ADORA2B)

Gene Names
ADORA2B; ADORA2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenosine receptor A2b (ADORA2B); Recombinant Human Adenosine receptor A2b (ADORA2B); ADORA2B recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-332aa; Full length protein
Sequence
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Sequence Length
332
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ADORA2B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
136
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,333 Da
NCBI Official Full Name
adenosine receptor A2b
NCBI Official Synonym Full Names
adenosine A2b receptor
NCBI Official Symbol
ADORA2B
NCBI Official Synonym Symbols
ADORA2
NCBI Protein Information
adenosine receptor A2b
UniProt Protein Name
Adenosine receptor A2b
Protein Family
UniProt Gene Name
ADORA2B
UniProt Entry Name
AA2BR_HUMAN

NCBI Description

This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

ADORA2B: Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p12

Cellular Component: integral to plasma membrane; intracellular; plasma membrane

Molecular Function: adenosine receptor activity, G-protein coupled

Biological Process: activation of MAPK activity; adenosine receptor signaling pathway; adenylate cyclase activation; cellular defense response; cellular protein metabolic process; cellular response to extracellular stimulus; excretion; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase activating pathway; JNK cascade; positive regulation of chemokine production; positive regulation of chronic inflammatory response to non-antigenic stimulus; positive regulation of guanylate cyclase activity; positive regulation of interleukin-6 production; positive regulation of mast cell degranulation; relaxation of vascular smooth muscle

Research Articles on ADORA2B

Similar Products

Product Notes

The ADORA2B adora2b (Catalog #AAA7007265) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-332aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ADORA2B adora2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLETQDALY VALELVIAAL SVAGNVLVCA AVGTANTLQT PTNYFLVSLA AADVAVGLFA IPFAITISLG FCTDFYGCLF LACFVLVLTQ SSIFSLLAVA VDRYLAICVP LRYKSLVTGT RARGVIAVLW VLAFGIGLTP FLGWNSKDSA TNNCTEPWDG TTNESCCLVK CLFENVVPMS YMVYFNFFGC VLPPLLIMLV IYIKIFLVAC RQLQRTELMD HSRTTLQREI HAAKSLAMIV GIFALCWLPV HAVNCVTLFQ PAQGKNKPKW AMNMAILLSH ANSVVNPIVY AYRNRDFRYT FHKIISRYLL CQADVKSGNG QAGVQPALGV GL. It is sometimes possible for the material contained within the vial of "Adenosine receptor A2b (ADORA2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.