Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Adiponectin Recombinant Protein | Acrp30 recombinant protein

Recombinant Human Adiponectin

Gene Names
ADIPOQ; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1
Purity
Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Synonyms
Adiponectin; Recombinant Human Adiponectin; Acrp30 Human; Adiponectin Human Recombinant; Acrp30; AdipoQ; GBP-28; APM-1; ACDC; Acrp30 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Form/Format
Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT.
Sterile Filtered clear solution.
Sequence
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Sequence Length
244
Patent Rights
The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A).
Preparation and Storage
Store Acrp30 at -20 degree C. Can be stored at 4 degree C for a limited period of time of 7 days.
Related Product Information for Acrp30 recombinant protein
Description: The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E Coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).

Introduction: The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.
Product Categories/Family for Acrp30 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,414 Da
NCBI Official Full Name
adiponectin
NCBI Official Synonym Full Names
adiponectin, C1Q and collagen domain containing
NCBI Official Symbol
ADIPOQ
NCBI Official Synonym Symbols
ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1
NCBI Protein Information
adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28
UniProt Protein Name
Adiponectin
Protein Family
UniProt Gene Name
ADIPOQ
UniProt Synonym Gene Names
ACDC; ACRP30; APM1; GBP28; ACRP30; apM-1
UniProt Entry Name
ADIPO_HUMAN

NCBI Description

This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]

Uniprot Description

adiponectin: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. Homomultimer. Forms trimers, hexamers and 12- to 18-mers. The trimers (low molecular weight complexes / LMW) are assembled via non-covalent interactions of the collagen-like domains in a triple helix and hydrophobic interactions within the globular C1q domain. Several trimers can associate to form disulfide-linked hexamers (middle molecular weight complexes / MMW) and larger complexes (higher molecular weight / HMW). The HMW-complex assembly may rely aditionally on lysine hydroxylation and glycosylation. LMW, MMW and HMW complexes bind to HBEGF, MMW and HMW complexes bind to PDGFB, and HMW complex binds to FGF2. Interacts with CTRP9A via the C1q domain (heterotrimeric complex). Synthesized exclusively by adipocytes and secreted into plasma.

Protein type: Secreted, signal peptide; Secreted; Endoplasmic reticulum; Hormone

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space; collagen; cell surface; endoplasmic reticulum; extracellular region

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; hormone activity; cytokine activity; sialic acid binding; receptor binding

Biological Process: circadian rhythm; negative regulation of phagocytosis; negative regulation of MAP kinase activity; negative regulation of smooth muscle cell proliferation; negative regulation of hormone secretion; membrane hyperpolarization; response to glucocorticoid stimulus; positive regulation of cellular protein metabolic process; negative regulation of smooth muscle cell migration; glucose homeostasis; negative regulation of granulocyte differentiation; positive regulation of interleukin-8 production; positive regulation of glucose import; negative regulation of gluconeogenesis; response to glucose stimulus; adiponectin-mediated signaling pathway; negative regulation of protein amino acid autophosphorylation; negative regulation of blood pressure; negative regulation of cell migration; response to nutrient; protein homooligomerization; generation of precursor metabolites and energy; positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of heterotypic cell-cell adhesion; positive regulation of signal transduction; glucose metabolic process; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of tumor necrosis factor production; negative regulation of fat cell differentiation; negative regulation of synaptic transmission; response to sucrose stimulus; membrane depolarization; positive regulation of peptidyl-tyrosine phosphorylation; fatty acid beta-oxidation; positive regulation of fatty acid metabolic process; response to ethanol; cellular response to insulin stimulus; negative regulation of low-density lipoprotein receptor biosynthetic process; negative regulation of macrophage differentiation; negative regulation of inflammatory response; brown fat cell differentiation; response to hypoxia; fatty acid oxidation; positive regulation of protein amino acid phosphorylation; response to activity; negative regulation of transcription, DNA-dependent; positive regulation of myeloid cell apoptosis; positive regulation of blood pressure

Disease: Adiponectin, Serum Level Of, Quantitative Trait Locus 1

Research Articles on Acrp30

Similar Products

Product Notes

The Acrp30 adipoq (Catalog #AAA142157) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGHDQETTTQ GPGVLLPLPK GACTGWMAGI PGHPGHNGAP GRDGRDGTPG EKGEKGDPGL IGPKGDIGET GVPGAEGPRG FPGIQGRKGE PGEGAYVYRS AFSVGLETYV TIPNMPIRFT KIFYNQQNHY DGSTGKFHCN IPGLYYFAYH ITVYMKDVKV SLFKKDKAML FTYDQYQENN VDQASGSVLL HLEVGDQVWL QVYGEGERNG LYADNDNDST FTGFLLYHDT N. It is sometimes possible for the material contained within the vial of "Adiponectin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.