EGF, latrophilin and seven transmembrane domain-containing protein 1 (ELTD1) Recombinant Protein | ELTD1 recombinant protein
Recombinant Human EGF, latrophilin and seven transmembrane domain-containing protein 1 (ELTD1)
Gene Names
ADGRL4; ETL; ELTD1; KPG_003
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EGF; latrophilin and seven transmembrane domain-containing protein 1 (ELTD1); Recombinant Human EGF; ELTD1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
20-690aa; full length protein
Sequence
QNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDNECGNLTQSCGENANCTNTE GSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEP VALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTISAKDTLSNSTLTEFVKTVN NFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFF FDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFVYYKSIGPLLSSSDNFLLKP QNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHRKVTDRYRSLCAFWNYSPDT MNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIGIKDYNILTRITQLGIIISL ICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVGINTNTNKLFCSIIAGLLHY FFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLSPAVVVGFSAALGYRYYGTT KVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHTAGLKPEVSCFENIRSCARG ALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLF KNVPCCFGCLR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ELTD1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
77,811 Da
NCBI Official Full Name
adhesion G protein-coupled receptor L4
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor L4
NCBI Official Symbol
ADGRL4
NCBI Official Synonym Symbols
ETL; ELTD1; KPG_003
NCBI Protein Information
adhesion G protein-coupled receptor L4
UniProt Protein Name
Adhesion G protein-coupled receptor L4
UniProt Gene Name
ADGRL4
UniProt Synonym Gene Names
ETL protein
UniProt Entry Name
AGRL4_HUMAN
Uniprot Description
ELTD1: Could be involved in cardiac development. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
Protein type: Membrane protein, multi-pass; GPCR, family 2; Membrane protein, integral; Receptor, GPCR
Chromosomal Location of Human Ortholog: 1p33-p32
Cellular Component: cytoplasmic vesicle; integral to membrane; plasma membrane
Molecular Function: calcium ion binding; G-protein coupled receptor activity; protein dimerization activity
Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway
Research Articles on ELTD1
Similar Products
Product Notes
The ELTD1 adgrl4 (Catalog #AAA7014233) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-690aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ELTD1 adgrl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QNCTKTPCLP NAKCEIRNGI EACYCNMGFS GNGVTICEDD NECGNLTQSC GENANCTNTE GSYYCMCVPG FRSSSNQDRF ITNDGTVCIE NVNANCHLDN VCIAANINKT LTKIRSIKEP VALLQEVYRN SVTDLSPTDI ITYIEILAES SSLLGYKNNT ISAKDTLSNS TLTEFVKTVN NFVQRDTFVV WDKLSVNHRR THLTKLMHTV EQATLRISQS FQKTTEFDTN STDIALKVFF FDSYNMKHIH PHMNMDGDYI NIFPKRKAAY DSNGNVAVAF VYYKSIGPLL SSSDNFLLKP QNYDNSEEEE RVISSVISVS MSSNPPTLYE LEKITFTLSH RKVTDRYRSL CAFWNYSPDT MNGSWSSEGC ELTYSNETHT SCRCNHLTHF AILMSSGPSI GIKDYNILTR ITQLGIIISL ICLAICIFTF WFFSEIQSTR TTIHKNLCCS LFLAELVFLV GINTNTNKLF CSIIAGLLHY FFLAAFAWMC IEGIHLYLIV VGVIYNKGFL HKNFYIFGYL SPAVVVGFSA ALGYRYYGTT KVCWLSTENN FIWSFIGPAC LIILVNLLAF GVIIYKVFRH TAGLKPEVSC FENIRSCARG ALALLFLLGT TWIFGVLHVV HASVVTAYLF TVSNAFQGMF IFLFLCVLSR KIQEEYYRLF KNVPCCFGCL R. It is sometimes possible for the material contained within the vial of "EGF, latrophilin and seven transmembrane domain-containing protein 1 (ELTD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
