Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EGF-like module-containing mucin-like hormone receptor-like 4 (Emr4) Recombinant Protein | Emr4 recombinant protein

Recombinant Mouse EGF-like module-containing mucin-like hormone receptor-like 4 (Emr4)

Gene Names
Adgre4; Emr4; Fire; Gpr127; Egf-tm7; D17Ertd479e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EGF-like module-containing mucin-like hormone receptor-like 4 (Emr4); Recombinant Mouse EGF-like module-containing mucin-like hormone receptor-like 4 (Emr4); Emr4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
38-689aa; full length protein
Sequence
CPQCNENASCFNSTHCVCKEGFWTGSENRRIIEPHEKCQDINECLLKELVCKDVSYCRNK IGTYICSCVVKYPLFNWVAGIINIDHPDCYVNKSKNTGSKTHTLGVLSEFKSKEEVAKGA TKLLRKVEHHILNENSDIPKKDENPLLDIVYETKRCKTMTLLEAGNNTMKVDCTSGFKEH NSGGETAVAFIAYKSLGNLLNGSFFSNEEGFQEVTLNSHIVSGAIRSEVKPVLSEPVLLT LQNIQPIDSRAEHLCVHWEGSEEGGSWSTKGCSHVYTNNSYTICKCFHLSSFAVLMALPH EEDGVLSALSVITYVGLSLSLLCLFLAAITFLLCRPIQNTSTTLHLQLSICLFLADLLFL TGINRTKPKVLCSIIAGMLHYLYLASFMWMFLEGLHLFLTVSNLKVANYSNSGRFKKRFM YPVGYGLPAFIVAVSAIAGHKNYGTHNHCWLSLHRGFIWSFLGPAAAIILINLVFYFLII WILRSKLSSLNKEVSTLQDTKVMTFKAIVQLFVLGCSWGIGLFIFIEVGKTVRLIVAYLF TIINVLQGVLIFMVHCLLNRQVRMEYKKWFHRLRKEVESESTEVSHSTTHTKMGLSLNLE NFCPTGNLHDPSDSILPSTEVAGVYLSTPRSHMGAEDVNSGTHAYWSRTISD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Emr4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,045 Da
NCBI Official Full Name
adhesion G protein-coupled receptor E4
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E4
NCBI Official Symbol
Adgre4
NCBI Official Synonym Symbols
Emr4; Fire; Gpr127; Egf-tm7; D17Ertd479e
NCBI Protein Information
adhesion G protein-coupled receptor E4
UniProt Protein Name
Adhesion G protein-coupled receptor E4
UniProt Gene Name
Adgre4
UniProt Synonym Gene Names
Emr4
UniProt Entry Name
AGRE4_MOUSE

Uniprot Description

EMR4P: Could mediated the cellular interaction between myeloid cells and B-cells. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 2; Receptor, GPCR

Cellular Component: cell surface; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: calcium ion binding; G-protein coupled receptor activity; signal transducer activity; transmembrane receptor activity

Biological Process: cell surface receptor linked signal transduction; epidermal growth factor receptor signaling pathway; G-protein coupled receptor protein signaling pathway; signal transduction

Research Articles on Emr4

Similar Products

Product Notes

The Emr4 adgre4 (Catalog #AAA7014259) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-689aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Emr4 adgre4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CPQCNENASC FNSTHCVCKE GFWTGSENRR IIEPHEKCQD INECLLKELV CKDVSYCRNK IGTYICSCVV KYPLFNWVAG IINIDHPDCY VNKSKNTGSK THTLGVLSEF KSKEEVAKGA TKLLRKVEHH ILNENSDIPK KDENPLLDIV YETKRCKTMT LLEAGNNTMK VDCTSGFKEH NSGGETAVAF IAYKSLGNLL NGSFFSNEEG FQEVTLNSHI VSGAIRSEVK PVLSEPVLLT LQNIQPIDSR AEHLCVHWEG SEEGGSWSTK GCSHVYTNNS YTICKCFHLS SFAVLMALPH EEDGVLSALS VITYVGLSLS LLCLFLAAIT FLLCRPIQNT STTLHLQLSI CLFLADLLFL TGINRTKPKV LCSIIAGMLH YLYLASFMWM FLEGLHLFLT VSNLKVANYS NSGRFKKRFM YPVGYGLPAF IVAVSAIAGH KNYGTHNHCW LSLHRGFIWS FLGPAAAIIL INLVFYFLII WILRSKLSSL NKEVSTLQDT KVMTFKAIVQ LFVLGCSWGI GLFIFIEVGK TVRLIVAYLF TIINVLQGVL IFMVHCLLNR QVRMEYKKWF HRLRKEVESE STEVSHSTTH TKMGLSLNLE NFCPTGNLHD PSDSILPSTE VAGVYLSTPR SHMGAEDVNS GTHAYWSRTI SD. It is sometimes possible for the material contained within the vial of "EGF-like module-containing mucin-like hormone receptor-like 4 (Emr4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.