Probable G-protein coupled receptor 123 (GPR123) Recombinant Protein | GPR123 recombinant protein
Recombinant Human Probable G-protein coupled receptor 123 (GPR123)
Gene Names
ADGRA1; GPR123
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 123 (GPR123); Recombinant Human Probable G-protein coupled receptor 123 (GPR123); GPR123 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-560aa; full length protein
Sequence
MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFC FHAALTFTVFAGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCL DTDQPPYPRQPLLRFYLVSGGVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFY GPAAIITLVTCVYFLGTYVQLRRHPGRRYELRTQPEEQRRLATPEGGRGIRPGTPPAHDA PGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQGHFLDMVFSCLYGAFCVTLGL FVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLGQPRGFAHPPG PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPM VTQPEGSDGSPALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLP FGTDGTGNIRTGPWKNETTV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPR123 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,101 Da
NCBI Official Full Name
adhesion G protein-coupled receptor A1 isoform 1
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor A1
NCBI Official Symbol
ADGRA1
NCBI Official Synonym Symbols
GPR123
NCBI Protein Information
adhesion G protein-coupled receptor A1
UniProt Protein Name
Adhesion G protein-coupled receptor A1
UniProt Gene Name
ADGRA1
UniProt Entry Name
AGRA1_HUMAN
NCBI Description
This gene encodes a protein that belongs to the adhesion family of G-protein-coupled receptors. Members of this family function in several sensory systems and regulate blood pressure, immune responses, food intake and development. A similar protein in rodents is thought to play a role in in the regulation of neuronal signaling pathways. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Mar 2014]
Uniprot Description
Orphan receptor.
Research Articles on GPR123
Similar Products
Product Notes
The GPR123 adgra1 (Catalog #AAA7016074) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-560aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPR123 adgra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDLKTVLSLP RYPGEFLHPV VYACTAVMLL CLLASFVTYI VHQSAIRISR KGRHTLLNFC FHAALTFTVF AGGINRTKYP ILCQAVGIVL HYSTLSTMLW IGVTARNIYK QVTKKAPLCL DTDQPPYPRQ PLLRFYLVSG GVPFIICGVT AATNIRNYGT EDEDTAYCWM AWEPSLGAFY GPAAIITLVT CVYFLGTYVQ LRRHPGRRYE LRTQPEEQRR LATPEGGRGI RPGTPPAHDA PGASVLQNEH SFQAQLRAAA FTLFLFTATW AFGALAVSQG HFLDMVFSCL YGAFCVTLGL FVLIHHCAKR EDVWQCWWAC CPPRKDAHPA LDANGAALGR AACLHSPGLG QPRGFAHPPG PCKMTNLQAA QGHASCLSPA TPCCAKMHCE PLTADEAHVH LQEEGAFGHD PHLHGCLQGR TKPPYFSRHP AEEPEYAYHI PSSLDGSPRS SRTDSPPSSL DGPAGTHTLA CCTQGDPFPM VTQPEGSDGS PALYSCPTQP GREAALGPGH LEMLRRTQSL PFGGPSQNGL PKGKLLEGLP FGTDGTGNIR TGPWKNETTV. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 123 (GPR123), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
