Adenosine monophosphate-protein transferase FICD homolog (GJ12914) Recombinant Protein | DvirGJ12914 recombinant protein
Recombinant Drosophila virilis Adenosine monophosphate-protein transferase FICD homolog (GJ12914)
Gene Names
DvirGJ12914; dvir_GLEANR_1285; GJ12914
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenosine monophosphate-protein transferase FICD homolog (GJ12914); Recombinant Drosophila virilis Adenosine monophosphate-protein transferase FICD homolog (GJ12914); Recombinant Adenosine monophosphate-protein transferase FICD homolog (GJ12914); Adenosine monophosphate-protein transferase FICD homolog EC= 2.7.7.n1; DvirGJ12914 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-485
Sequence
MAKAKAKQEPQQQRQTLQATYRFVLFFIAGSLAAFAFHALTSSTGSLMGWRLRLHHLPTAHYLQTRDEFAVYSVDELNAFKEFYDKSISDSVGASFTEAEQTNIKEAMGALRLAQEMYMAGKDDKAARLFEHALALAPKHPEVLLRYGEFLEHNQRNIVLADQYYFQALCISPSNSEALANRQRTADVVQTLDERRLISLDEKRDALSAIHEANSALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSVLETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKLEITLKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLAILMQRFEHWLNSEHSSSLHPVNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTENEGHVLAQLQPHIAQSIPELHESGSGSGSGADPIRVP
Sequence Length
485
Species
Drosophila virilis (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,741 Da
NCBI Official Full Name
GJ12914
NCBI Official Symbol
DvirGJ12914
NCBI Official Synonym Symbols
dvir_GLEANR_1285; GJ12914
NCBI Protein Information
GJ12914 gene product from transcript GJ12914-RA; DvirGJ12914-PA
UniProt Protein Name
Adenosine monophosphate-protein transferase FICD homolog
UniProt Entry Name
FICD_DROVI
Uniprot Description
Function: Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins
By similarity.
Catalytic activity: ATP + [protein] = diphosphate + [protein]-AMP.
Enzyme regulation: Adenylyltransferase activity is inhibited by the inhibitory helix present at the N-terminus: Glu-236 binds ATP and competes with ATP-binding at Arg-375, thereby preventing adenylyltransferase activity. Activation dissociates ATP-binding from Glu-236, allowing ordered binding of the entire ATP moiety with the alpha-phosphate in an orientation that is productive for accepting an incoming target hydroxyl side chain
By similarity.
Subcellular location: Membrane; Single-pass membrane protein
Potential.
Domain: The fido domain mediates the adenylyltransferase activity
By similarity.
Sequence similarities: Belongs to the fic family.Contains 1 fido domain.Contains 2 TPR repeats.
Similar Products
Product Notes
The DvirGJ12914 (Catalog #AAA1092433) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-485. The amino acid sequence is listed below: MAKAKAKQEP QQQRQTLQAT YRFVLFFIAG SLAAFAFHAL TSSTGSLMGW RLRLHHLPTA HYLQTRDEFA VYSVDELNAF KEFYDKSISD SVGASFTEAE QTNIKEAMGA LRLAQEMYMA GKDDKAARLF EHALALAPKH PEVLLRYGEF LEHNQRNIVL ADQYYFQALC ISPSNSEALA NRQRTADVVQ TLDERRLISL DEKRDALSAI HEANSALRRA KKEAYFQHIY HSVGIEGNTM TLAQTRSVLE TRMAVDGKSI DEHNEILGMD LAMKYINASL VQKLEITLKD ILELHRRVLG HVDPIEGGEF RRNQVYVGGH VPPGPGDLAI LMQRFEHWLN SEHSSSLHPV NYAALAHYKL VHIHPFVDGN GRTSRLLMNT LLMRAGYPPV IIPKQQRSKY YHFLKLANEG DIRPFVRFIA DCTEKTLDLY LWATSDLPQQ IPMLIQTENE GHVLAQLQPH IAQSIPELHE SGSGSGSGAD PIRVP. It is sometimes possible for the material contained within the vial of "Adenosine monophosphate-protein transferase FICD homolog (GJ12914), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
