Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Trypsin Active Protein | ANASTE_00397 active protein

Recombinant Porcine Trypsin

Synonyms
Trypsin; Recombinant Porcine Trypsin; Trypsin Porcine; Trypsin Porcine Recombinant; pTrypsin; ANASTE_00397 active protein
Ordering
For Research Use Only!
Host
Pichia Pastoris
Form/Format
The Porcine Trypsin (2.98mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH-3.
Sterile Filtered clear liquid solution.
Sequence
VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Sequence Length
382
Biological Activity
3,394 BAEE units/mg powder.
Preparation and Storage
Recombinant Porcine Trypsin should be stored at 2-8 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Related Product Information for ANASTE_00397 active protein
Description: Recombinant Porcine Trypsin is free from any animal and human sources. Recombinant Porcine Trypsin expressed in Yeast and purified by standard chromatography techniques. Recombinant Porcine Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA.

Introduction: Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-alpha-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
Product Categories/Family for ANASTE_00397 active protein

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
39,727 Da
NCBI Official Full Name
trypsin
UniProt Protein Name
Trypsin
Protein Family
UniProt Gene Name
ANASTE_00397
UniProt Entry Name
B1C6Q1_9FIRM

Similar Products

Product Notes

The Trypsin anaste_00397 (Catalog #AAA144846) is an Active Protein produced from Pichia Pastoris and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VGGYTCAANS IPYQVSLNSG SHFCGGSLIN SQWVVSAAHC YKSRIQVRLG EHNIDVLEGN EQFINAAKII THPNFNGNTL DNDIMLIKLS SPATLNSRVA TVSLPRSCAA AGTECLISGW GNTKSSGSSY PSLLQCLKAP VLSDSSCKSS YPGQITGNMI CVGFLEGGKD SCQGDSGGPV VCNGQLQGIV SWGYGCAQKN KPGVYTKVCN YVNWIQQTIA AN. It is sometimes possible for the material contained within the vial of "Trypsin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.