Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Teduglutide Active Protein

Teduglutide

Synonyms
Teduglutide; H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; [Gly2]-GLP-2 (human); Teduglutide active protein
Ordering
For Research Use Only!
Form/Format
Trifluoroacetate
Molecular Formula
C164H252N44O55S
One-Letter Code
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
CAS Number
197922-42-2
Preparation and Storage
Store at -20 degree C
Related Product Information for Teduglutide active protein
Glucagon-like Peptide-2 Analog Used to Treat Short Bowel Syndrome. Bolar Exemption applies.This is a FDA-regulated product. It is the responsibility of the customer to ensure that they are complying with Federal rules. PI cannot be liable for infringement of rights made by the user.
Product Categories/Family for Teduglutide active protein
References
Jeppesen, P., et al.: Gut, 54, 1224 (2005).
Jeppesen, P.B., Therap. Adv. Gastroenterol., 5,159 (2012).
D. J. Drucker et al., American Journal of Physiology - Gastrointestinal and Liver Physiology, 276(1), G79 (1999).

Similar Products

Product Notes

The Teduglutide (Catalog #AAA407577) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. It is sometimes possible for the material contained within the vial of "Teduglutide, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.