Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Low molecular weight phosphotyrosine protein phosphatase (ACP1) Recombinant Protein | ACP1 recombinant protein

Recombinant Human Low molecular weight phosphotyrosine protein phosphatase (ACP1)

Gene Names
ACP1; HAAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Low molecular weight phosphotyrosine protein phosphatase (ACP1); Recombinant Human Low molecular weight phosphotyrosine protein phosphatase (ACP1); Low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; EC=3.1.3.48; Adipocyte acid phosphatase; Low molecular weight cytosolic acid phosphatase; EC=3.1.3.2; Red cell acid phosphatase 1; ACP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-158aa; Full Length of Isoform 1
Sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Sequence Length
157
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for ACP1 recombinant protein
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Product Categories/Family for ACP1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
52
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
low molecular weight phosphotyrosine protein phosphatase isoform d
NCBI Official Synonym Full Names
acid phosphatase 1, soluble
NCBI Official Symbol
ACP1
NCBI Official Synonym Symbols
HAAP
NCBI Protein Information
low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase
UniProt Protein Name
Low molecular weight phosphotyrosine protein phosphatase
UniProt Gene Name
ACP1
UniProt Synonym Gene Names
LMW-PTP; LMW-PTPase
UniProt Entry Name
PPAC_HUMAN

NCBI Description

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

ACP1: a phosphotyrosine protein phosphatase. Functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. Hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. Genetically polymorphic with three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Three transcript variants encoding distinct isoforms have been identified for this gene.

Protein type: Cofactor and Vitamin Metabolism - riboflavin; Motility/polarity/chemotaxis; EC 3.1.3.2; Phosphatase (non-protein); EC 3.1.3.48; Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: internal side of plasma membrane; cytoplasm

Molecular Function: acid phosphatase activity; protein binding; non-membrane spanning protein tyrosine phosphatase activity

Research Articles on ACP1

Similar Products

Product Notes

The ACP1 acp1 (Catalog #AAA957837) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-158aa; Full Length of Isoform 1. The amino acid sequence is listed below: MAEQATKSVL FVCLGNICRS PIAEAVFRKL VTDQNISENW RVDSAATSGY EIGNPPDYRG QSCMKRHGIP MSHVARQITK EDFATFDYIL CMDESNLRDL NRKSNQVKTC KAKIELLGSY DPQKQLIIED PYYGNDSDFE TVYQQCVRCC RAFLEKAH. It is sometimes possible for the material contained within the vial of "Low molecular weight phosphotyrosine protein phosphatase (ACP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.