3-ketoacyl-CoA reductase Recombinant Protein | ACLA_070510 recombinant protein
Recombinant Aspergillus clavatus 3-ketoacyl-CoA reductase (ACLA_070510)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA reductase; Recombinant Aspergillus clavatus 3-ketoacyl-CoA reductase (ACLA_070510); ACLA_070510 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-345aa; full length protein
Sequence
MDFVSKYMSCLSSWGLDLQPGLQSVGAAVLLATGGLFLASRVLTFVRVLLSLFVLPGKPL RSFGPKGSWAVVTGASDGLGKEFALQLARAGFNIVLVSRTASKLATLAEEITAKHSVQTR TLAMDFAANDDTDYEDLKTLVDGLDVSILINNVGKSHDIPVPFALTPEDEMTDIVTINCL GTLRATQLVIPGMMQRRRGLVLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPY GITVELVQAYLITSAMSKVRRTSALIPSPRAFVSSVLSKIGRNGGSPTYSYSSSPYWSHG LMAYFLTCVLQPMGKLVVGQNRTMHEAIRKRALRKAEREKGKKST
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ACLA_070510 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,244 Da
NCBI Official Full Name
ketoreductase, putative
NCBI Official Symbol
ACLA_070510
NCBI Protein Information
ketoreductase, putative
UniProt Protein Name
Very-long-chain 3-oxoacyl-CoA reductase
UniProt Gene Name
ACLA_070510
UniProt Synonym Gene Names
3-ketoreductase; KAR
UniProt Entry Name
MKAR_ASPCL
Uniprot Description
Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Similar Products
Product Notes
The ACLA_070510 acla_070510 (Catalog #AAA7036510) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-345aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ACLA_070510 acla_070510 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDFVSKYMSC LSSWGLDLQP GLQSVGAAVL LATGGLFLAS RVLTFVRVLL SLFVLPGKPL RSFGPKGSWA VVTGASDGLG KEFALQLARA GFNIVLVSRT ASKLATLAEE ITAKHSVQTR TLAMDFAAND DTDYEDLKTL VDGLDVSILI NNVGKSHDIP VPFALTPEDE MTDIVTINCL GTLRATQLVI PGMMQRRRGL VLTMGSFGGL LPTPLLATYS GSKAFLQQWS TSLGSELEPY GITVELVQAY LITSAMSKVR RTSALIPSPR AFVSSVLSKI GRNGGSPTYS YSSSPYWSHG LMAYFLTCVL QPMGKLVVGQ NRTMHEAIRK RALRKAEREK GKKST. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA reductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
