Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Accessory protein p12I Recombinant Protein

Recombinant Human T-cell leukemia virus 1 Accessory protein p12I

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Accessory protein p12I; Recombinant Human T-cell leukemia virus 1 Accessory protein p12I; Recombinant Accessory protein p12I; Accessory protein p12I recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-99
Sequence
MLFRLLSPLSPLALTALLLFLLPPSDVSGLLLRPPPAPCLLLFLPFQILSGLLFLLFLPLFFSLPLLLSPSLPITMRFPARWRFLPWKAPSQPAAAFLF
Sequence Length
99
Species
Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
11,069 Da
NCBI Official Full Name
Accessory protein p12I
UniProt Protein Name
Accessory protein p12I
Protein Family
UniProt Entry Name
P12I_HTL1A

Uniprot Description

Function: p12I is a modulator of T-lymphocyte proliferation and immune function and may contribute to establish a persistent infection. Binds and down-modulates cell surface expression of interleukin-2 receptors IL2RB and IL2RG. Also down-modulates cell surface MHC-I molecules by binding to free immature MHC-I heavy chains in the ER and targeting them to the proteasome for degradation. Binding to IL2RB mediates recruitment of JAK1 and JAK3. As a result of this interaction, p12I increases DNA-binding and transcriptional activity of STAT5

By similarity. Ref.8 Ref.9

Subunit structure: p12I is a homodimer. Interacts with human CANX, CALR, ATP6V0C, IL2RB, IL2RG. Binds to MHC-I heavy chains HLA-A2, HLA-B7 and HLA-Cw4. Ref.4 Ref.5 Ref.6 Ref.7 Ref.9

Subcellular location: Isoform p12I: Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus › host cis-Golgi network membrane; Multi-pass membrane protein

Potential Ref.2 Ref.7.

Post-translational modification: Ubiquitinated; a fraction of P12I is degraded via the ubiquitin system. Ref.4

Miscellaneous: Lys-88 seems to be associated with tropical spastic paraparesis/HTLV-1-associated myelopathy (TSP/HAM).HTLV-1 lineages are divided in four clades, A (Cosmopolitan), B (Central African group), C (Melanesian group) and D (New Central African group).

Sequence similarities: Belongs to the HTLV-1 accessory protein p12I family.

Similar Products

Product Notes

The Accessory protein p12I (Catalog #AAA1134250) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-99. The amino acid sequence is listed below: MLFRLLSPLS PLALTALLLF LLPPSDVSGL LLRPPPAPCL LLFLPFQILS GLLFLLFLPL FFSLPLLLSP SLPITMRFPA RWRFLPWKAP SQPAAAFLF. It is sometimes possible for the material contained within the vial of "Accessory protein p12I, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.