Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD) Recombinant Protein | accD recombinant protein
Recombinant Dioscorea elephantipes Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; chloroplastic (accD); Recombinant Dioscorea elephantipes Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; accD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-489, Full length protein
Sequence
MEKWWWFNSILSNERLEHRYGLSKSMDSVNGIEYTKDPILNDTEKNILGWSDSSNYSFSTVDYLFEIRNIWSLISDDTFLVRDSNGDSYSVYFDIENQIFEIDNNSSFLGELESFFSSYLNRGSKNKYYHYMYDTQFSWNNHITNCIDSYLRFEIGISITSYISGDIVNYSDGYIYSFICTESVSSNESGSSSIRTSSNGSDFNMRENSNDSDINKKYRHLWVQCENCYGLNYKKFFRSKMNICEQCGYHLKMSSSDRIEVSIDPDTWDPMDEDMVSIDPIEFHSEEEPYRDRIDSYQRKTGLTEAIQTGIGQLNGIPIAIGVMDFQFMGGSMGSVVGEKITRLIEYATNESLPVIIVCASGGARMQEGSLSLMQMAKISSASYNYQSNKKLFYVSILTSPTTGGVTASFGMLGDVIIAEPNAYIAFAGKRVIEQTLNKTVPDGSQSAEYLFHKGLFDPIVPRNPLKGVLSELFQLHGFLPLNQNKKEN
Sequence Length
489
Species
Dioscorea elephantipes (Elephant's foot)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,633 Da
NCBI Official Full Name
acetyl-CoA carboxylase beta subunit (chloroplast)
NCBI Official Symbol
accD
NCBI Protein Information
acetyl-CoA carboxylase beta subunit
UniProt Protein Name
Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic
Protein Family
UniProt Gene Name
accD
UniProt Synonym Gene Names
ACCase subunit beta; Acetyl-CoA carboxylase carboxyltransferase subunit beta
Uniprot Description
Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO2 group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.
Similar Products
Product Notes
The accD accd (Catalog #AAA1216089) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-489, Full length protein. The amino acid sequence is listed below: MEKWWWFNSI LSNERLEHRY GLSKSMDSVN GIEYTKDPIL NDTEKNILGW SDSSNYSFST VDYLFEIRNI WSLISDDTFL VRDSNGDSYS VYFDIENQIF EIDNNSSFLG ELESFFSSYL NRGSKNKYYH YMYDTQFSWN NHITNCIDSY LRFEIGISIT SYISGDIVNY SDGYIYSFIC TESVSSNESG SSSIRTSSNG SDFNMRENSN DSDINKKYRH LWVQCENCYG LNYKKFFRSK MNICEQCGYH LKMSSSDRIE VSIDPDTWDP MDEDMVSIDP IEFHSEEEPY RDRIDSYQRK TGLTEAIQTG IGQLNGIPIA IGVMDFQFMG GSMGSVVGEK ITRLIEYATN ESLPVIIVCA SGGARMQEGS LSLMQMAKIS SASYNYQSNK KLFYVSILTS PTTGGVTASF GMLGDVIIAE PNAYIAFAGK RVIEQTLNKT VPDGSQSAEY LFHKGLFDPI VPRNPLKGVL SELFQLHGFL PLNQNKKEN. It is sometimes possible for the material contained within the vial of "Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
