Abhydrolase domain-containing protein 2 (Abhd2) Recombinant Protein | Abhd2 recombinant protein
Recombinant Mouse Abhydrolase domain-containing protein 2 (Abhd2)
Gene Names
Abhd2; LABH2; Labh-2; 2210009N18Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Abhydrolase domain-containing protein 2 (Abhd2); Recombinant Mouse Abhydrolase domain-containing protein 2 (Abhd2); Abhd2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-425aa; full length protein
Sequence
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG CTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQM EAELE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abhd2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,378 Da
NCBI Official Full Name
monoacylglycerol lipase ABHD2
NCBI Official Synonym Full Names
abhydrolase domain containing 2
NCBI Official Symbol
Abhd2
NCBI Official Synonym Symbols
LABH2; Labh-2; 2210009N18Rik
NCBI Protein Information
monoacylglycerol lipase ABHD2
UniProt Protein Name
Monoacylglycerol lipase ABHD2
Protein Family
UniProt Gene Name
Abhd2
UniProt Synonym Gene Names
; MmLABH2
UniProt Entry Name
ABHD2_MOUSE
Uniprot Description
ABHD2: May play a role in smooth muscle cells migration. Belongs to the AB hydrolase superfamily. AB hydrolase 4 family.
Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; EC 3.1.1.-; Hydrolase
Cellular Component: integral to membrane; membrane
Molecular Function: 1-oxa-2-oxocycloheptane lactonase activity; 3,4-dihydrocoumarin hydrolase activity; acylglycerol lipase activity; all-trans-retinyl-palmitate hydrolase activity; butyrolactone hydrolase activity; hormone binding; hydrolase activity; lipase activity; phospholipase activity; prenylcysteine methylesterase activity; retinyl-palmitate esterase activity; steroid hormone receptor activity; sulfolactone hydrolase activity
Biological Process: acylglycerol catabolic process; negative regulation of cell migration; response to progesterone stimulus; response to wounding; sperm capacitation; steroid hormone mediated signaling
Research Articles on Abhd2
Similar Products
Product Notes
The Abhd2 abhd2 (Catalog #AAA7007195) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abhd2 abhd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNAMLETPEL PAVFDGVKLA AVAAVLYVIV RCLNLKSPTA PPDLYFQDSG LSRFLLKSCP LLTKEYIPPL IWGKSGHIQT ALYGKMGRVR SPHPYGHRKF ITMSDGATST FDLFEPLAEH CVGDDITMVI CPGIANHSEK QYIRTFVDYA QKNGYRCAVL NHLGALPNIE LTSPRMFTYG CTWEFGAMVN YIKRTYPQTQ LVVVGFSLGG NIVCKYLGET QANQEKVLCC VSVCQGYSAL RAQETFMQWD QCRRFYNFLM ADNMKKIILS HRQALFGDHV KKPQSLEDTD LSRLYTATSL MQIDDNVMRK FHGYNSLKEY YEEESCMRYL HRIYVPLMLV NAADDPLVHE SLLTIPKSLS EKRENVMFVL PLHGGHLGFF EGSVLFPEPL TWMDKLVVEY ANAICQWERN KSQCSDTEQM EAELE. It is sometimes possible for the material contained within the vial of "Abhydrolase domain-containing protein 2 (Abhd2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
