Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Abhydrolase domain-containing protein 16A (Abhd16a) Recombinant Protein | Abhd16a recombinant protein

Recombinant Rat Abhydrolase domain-containing protein 16A (Abhd16a)

Gene Names
Abhd16a; Bat5; NG26
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Abhydrolase domain-containing protein 16A (Abhd16a); Recombinant Rat Abhydrolase domain-containing protein 16A (Abhd16a); Abhd16a recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-558aa; full length protein
Sequence
AKLLSCVLGPRLYKIYRERDTDRAATSVPETPTAVPAASSSSWDSYYQPRALEKHADSIL ALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLVLLAGVACLRGIGRWTN PQYRQFITILEATHRNQSAENKRQLANYNFDFRSWPVDFHWEEPSSRKGSRGGPSRRGVA LLRPEPLHRGTADTFLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQ ARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL EAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIVIYAWSIGGFTA TWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVTRTVRQHLNLNNAEQLCRFQGP VLLVRRTKDEIITTTVPEDIMSNRGNDLLLKLLQFRYPRVMTEEGLRAVRQWLEASSQLE EASIYSRWEVDEDWCVSVLRSYQAEHGPDFPWSVGEDMSVDGRRQLALFLARKHLHNFEA THCTPLPAQHFQMPWCL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abhd16a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,038 Da
NCBI Official Full Name
protein ABHD16A
NCBI Official Synonym Full Names
abhydrolase domain containing 16A
NCBI Official Symbol
Abhd16a
NCBI Official Synonym Symbols
Bat5; NG26
NCBI Protein Information
protein ABHD16A
UniProt Protein Name
Protein ABHD16A
Protein Family
UniProt Gene Name
Abhd16a
UniProt Synonym Gene Names
Abhydrolase domain-containing protein 16A
UniProt Entry Name
ABHGA_RAT

Uniprot Description

BAT5: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity. Alternatively spliced transcript variants have been described. [provided by RefSeq, Apr 2010]

Protein type: Membrane protein, multi-pass; Membrane protein, integral; EC 3.-.-.-

Cellular Component: integral to membrane

Molecular Function: hydrolase activity

Research Articles on Abhd16a

Similar Products

Product Notes

The Abhd16a abhd16a (Catalog #AAA7007191) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-558aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abhd16a abhd16a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AKLLSCVLGP RLYKIYRERD TDRAATSVPE TPTAVPAASS SSWDSYYQPR ALEKHADSIL ALASVFWSIS YYSSPFAFFY LYRKGYLSLS KVVPFSHYAG TLLVLLAGVA CLRGIGRWTN PQYRQFITIL EATHRNQSAE NKRQLANYNF DFRSWPVDFH WEEPSSRKGS RGGPSRRGVA LLRPEPLHRG TADTFLNRVK KLPCQITSYL VAHTLGRRML YPGSVYLLQK ALMPVLLQGQ ARLVEECNGR RAKLLACDGN EIDTMFVDRR GTAEPQGQKL VICCEGNAGF YEVGCVSTPL EAGYSVLGWN HPGFAGSTGV PFPQNEANAM DVVVQFAIHR LGFQPQDIVI YAWSIGGFTA TWAAMSYPDI SAVILDASFD DLVPLALKVM PDSWRALVTR TVRQHLNLNN AEQLCRFQGP VLLVRRTKDE IITTTVPEDI MSNRGNDLLL KLLQFRYPRV MTEEGLRAVR QWLEASSQLE EASIYSRWEV DEDWCVSVLR SYQAEHGPDF PWSVGEDMSV DGRRQLALFL ARKHLHNFEA THCTPLPAQH FQMPWCL. It is sometimes possible for the material contained within the vial of "Abhydrolase domain-containing protein 16A (Abhd16a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.