Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Alpha/beta hydrolase domain-containing protein 14B Recombinant Protein | ABHD14B recombinant protein

Recombinant Human Alpha/beta hydrolase domain-containing protein 14B

Gene Names
ABHD14B; CIB; HEL-S-299
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha/beta hydrolase domain-containing protein 14B; Recombinant Human Alpha/beta hydrolase domain-containing protein 14B; ABHD14B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-210aa; Full Length
Sequence
AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
Sequence Length
210
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for ABHD14B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.2 kDa
NCBI Official Full Name
alpha/beta hydrolase domain-containing protein 14B isoform 1
NCBI Official Synonym Full Names
abhydrolase domain containing 14B
NCBI Official Symbol
ABHD14B
NCBI Official Synonym Symbols
CIB; HEL-S-299
NCBI Protein Information
alpha/beta hydrolase domain-containing protein 14B
UniProt Protein Name
Protein ABHD14B
Protein Family
UniProt Gene Name
ABHD14B
UniProt Synonym Gene Names
Abhydrolase domain-containing protein 14B
UniProt Entry Name
ABHEB_HUMAN

Uniprot Description

ABHD14B: Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription. Belongs to the AB hydrolase superfamily. ABHD14 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.-.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 3p21.2

Cellular Component: cytoplasm; cytosol; nucleolus; nucleus

Molecular Function: hydrolase activity; protein binding

Biological Process: 3'-phosphoadenosine 5'-phosphosulfate metabolic process; positive regulation of transcription from RNA polymerase II promoter; xenobiotic metabolic process

Similar Products

Product Notes

The ABHD14B abhd14b (Catalog #AAA1280186) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-210aa; Full Length. The amino acid sequence is listed below: AASVEQREGT IQVQGQALFF REALPGSGQA RFSVLLLHGI RFSSETWQNL GTLHRLAQAG YRAVAIDLPG LGHSKEAAAP APIGELAPGS FLAAVVDALE LGPPVVISPS LSGMYSLPFL TAPGSQLPGF VPVAPICTDK INAANYASVK TPALIVYGDQ DPMGQTSFEH LKQLPNHRVL IMKGAGHPCY LDKPEEWHTG LLDFLQGLQ. It is sometimes possible for the material contained within the vial of "Alpha/beta hydrolase domain-containing protein 14B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.