ABC transporter G family member 25 (ABCG25) Recombinant Protein | ABCG25 recombinant protein
Recombinant Arabidopsis thaliana ABC transporter G family member 25 (ABCG25)
Gene Names
ABCG25; ARABIDOPSIS THALIANA ATP-BINDING CASETTE FAMILY G 25; ATABCG25; ATP-binding casette family G25; F17M19.11; F17M19_11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ABC transporter G family member 25 (ABCG25); Recombinant Arabidopsis thaliana ABC transporter G family member 25 (ABCG25); ABCG25 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-662aa; full length protein
Sequence
MSAFDGVENQMNGPDSSPRLSQDPREPRSLLSSSCFPITLKFVDVCYRVKIHGMSNDSCN IKKLLGLKQKPSDETRSTEERTILSGVTGMISPGEFMAVLGPSGSGKSTLLNAVAGRLHG SNLTGKILINDGKITKQTLKRTGFVAQDDLLYPHLTVRETLVFVALLRLPRSLTRDVKLR AAESVISELGLTKCENTVVGNTFIRGISGGERKRVSIAHELLINPSLLVLDEPTSGLDAT AALRLVQTLAGLAHGKGKTVVTSIHQPSSRVFQMFDTVLLLSEGKCLFVGKGRDAMAYFE SVGFSPAFPMNPADFLLDLANGVCQTDGVTEREKPNVRQTLVTAYDTLLAPQVKTCIEVS HFPQDNARFVKTRVNGGGITTCIATWFSQLCILLHRLLKERRHESFDLLRIFQVVAASIL CGLMWWHSDYRDVHDRLGLLFFISIFWGVLPSFNAVFTFPQERAIFTRERASGMYTLSSY FMAHVLGSLSMELVLPASFLTFTYWMVYLRPGIVPFLLTLSVLLLYVLASQGLGLALGAA IMDAKKASTIVTVTMLAFVLTGGYYVNKVPSGMVWMKYVSTTFYCYRLLVAIQYGSGEEI LRMLGCDSKGKQGASAATSAGCRFVEEEVIGDVGMWTSVGVLFLMFFGYRVLAYLALRRI KH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ABCG25 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72,903 Da
NCBI Official Full Name
ABC transporter G family member 25
NCBI Official Symbol
ABCG25
NCBI Official Synonym Symbols
ARABIDOPSIS THALIANA ATP-BINDING CASETTE FAMILY G 25; ATABCG25; ATP-binding casette family G25; F17M19.11; F17M19_11
NCBI Protein Information
ABC transporter G family member 25
UniProt Protein Name
ABC transporter G family member 25
Protein Family
UniProt Gene Name
ABCG25
UniProt Synonym Gene Names
WBC26; ABC transporter ABCG.25; AtABCG25; AtWBC26
UniProt Entry Name
AB25G_ARATH
NCBI Description
Encodes a plasma membrane localized ABC transporter involved in abscisic acid transport and responses.
Research Articles on ABCG25
Similar Products
Product Notes
The ABCG25 abcg25 (Catalog #AAA7007157) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-662aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ABCG25 abcg25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSAFDGVENQ MNGPDSSPRL SQDPREPRSL LSSSCFPITL KFVDVCYRVK IHGMSNDSCN IKKLLGLKQK PSDETRSTEE RTILSGVTGM ISPGEFMAVL GPSGSGKSTL LNAVAGRLHG SNLTGKILIN DGKITKQTLK RTGFVAQDDL LYPHLTVRET LVFVALLRLP RSLTRDVKLR AAESVISELG LTKCENTVVG NTFIRGISGG ERKRVSIAHE LLINPSLLVL DEPTSGLDAT AALRLVQTLA GLAHGKGKTV VTSIHQPSSR VFQMFDTVLL LSEGKCLFVG KGRDAMAYFE SVGFSPAFPM NPADFLLDLA NGVCQTDGVT EREKPNVRQT LVTAYDTLLA PQVKTCIEVS HFPQDNARFV KTRVNGGGIT TCIATWFSQL CILLHRLLKE RRHESFDLLR IFQVVAASIL CGLMWWHSDY RDVHDRLGLL FFISIFWGVL PSFNAVFTFP QERAIFTRER ASGMYTLSSY FMAHVLGSLS MELVLPASFL TFTYWMVYLR PGIVPFLLTL SVLLLYVLAS QGLGLALGAA IMDAKKASTI VTVTMLAFVL TGGYYVNKVP SGMVWMKYVS TTFYCYRLLV AIQYGSGEEI LRMLGCDSKG KQGASAATSA GCRFVEEEVI GDVGMWTSVG VLFLMFFGYR VLAYLALRRI KH. It is sometimes possible for the material contained within the vial of "ABC transporter G family member 25 (ABCG25), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
