Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-binding cassette sub-family D member 3 (Abcd3) Recombinant Protein | Abcd3 recombinant protein

Recombinant Rat ATP-binding cassette sub-family D member 3 (Abcd3)

Gene Names
Abcd3; PMP70; Pxmp1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-binding cassette sub-family D member 3 (Abcd3); Recombinant Rat ATP-binding cassette sub-family D member 3 (Abcd3); Abcd3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-659aa; Full length protein
Sequence
AAFSKYLTARNSSLAGAAFLLFCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDK VFLSRLSQILKIMVPRTFCKETGYLILIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSKD FKRYLFNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDNR IANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVSG LFLTRLRRPIGKMTIMEQKYEGEYRFVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLVE HLHNFIFFRFSMGFIDSIIAKYIATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQSG RMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQDKGIEGA QASPLIPGAGEIINADNIIKFDHVPLATPNGDILIQDLSFEVRSGANVLICGPNGCGKSS LFRVLGELWPLFGGHLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGKEDQKKKGISDQV LKGYLDNVQLGHILEREGGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAV SVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKKITEDTVEFGS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abcd3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,316 Da
NCBI Official Full Name
ATP-binding cassette sub-family D member 3
NCBI Official Synonym Full Names
ATP binding cassette subfamily D member 3
NCBI Official Symbol
Abcd3
NCBI Official Synonym Symbols
PMP70; Pxmp1
NCBI Protein Information
ATP-binding cassette sub-family D member 3
UniProt Protein Name
ATP-binding cassette sub-family D member 3
Protein Family
UniProt Gene Name
Abcd3
UniProt Synonym Gene Names
Pmp70; Pxmp1; PMP70
UniProt Entry Name
ABCD3_RAT

NCBI Description

may form an ATP binding channel; may play a role in active transport in peroxisomes [RGD, Feb 2006]

Uniprot Description

ABCD3: a member of the superfamily of ATP-binding cassette (ABC) transporters. Likely plays an important role in peroxisome biogenesis. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. Defects in ABCD3 may be the cause of Zellweger syndrome-2 (ZWS-2), an autosomal recessive disorder due to defective import mechanisms for peroxisomal matrix enzymes.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Mitochondrial; Transporter, ABC family; Transporter

Cellular Component: integral to membrane; intracellular membrane-bound organelle; membrane; mitochondrial inner membrane; mitochondrion; peroxisomal matrix; peroxisomal membrane; peroxisome

Molecular Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; long-chain fatty acid transporter activity; protein binding; protein homodimerization activity; protein self-association

Biological Process: fatty acid beta-oxidation; fatty acid biosynthetic process; peroxisomal long-chain fatty acid import; peroxisome organization and biogenesis; response to drug; response to organic cyclic substance; transmembrane transport; very-long-chain fatty acid catabolic process

Research Articles on Abcd3

Similar Products

Product Notes

The Abcd3 abcd3 (Catalog #AAA7007126) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-659aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abcd3 abcd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AAFSKYLTAR NSSLAGAAFL LFCLLHKRRR ALGLHGKKSG KPPLQNNEKE GKKERAVVDK VFLSRLSQIL KIMVPRTFCK ETGYLILIAV MLVSRTYCDV WMIQNGTLIE SGIIGRSSKD FKRYLFNFIA AMPLISLVNN FLKYGLNELK LCFRVRLTRY LYEEYLQAFT YYKMGNLDNR IANPDQLLTQ DVEKFCNSVV DLYSNLSKPF LDIVLYIFKL TSAIGAQGPA SMMAYLLVSG LFLTRLRRPI GKMTIMEQKY EGEYRFVNSR LITNSEEIAF YNGNKREKQT IHSVFRKLVE HLHNFIFFRF SMGFIDSIIA KYIATVVGYL VVSRPFLDLA HPRHLHSTHS ELLEDYYQSG RMLLRMSQAL GRIVLAGREM TRLAGFTARI TELMQVLKDL NHGKYERTMV SQQDKGIEGA QASPLIPGAG EIINADNIIK FDHVPLATPN GDILIQDLSF EVRSGANVLI CGPNGCGKSS LFRVLGELWP LFGGHLTKPE RGKLFYVPQR PYMTLGTLRD QVIYPDGKED QKKKGISDQV LKGYLDNVQL GHILEREGGW DSVQDWMDVL SGGEKQRMAM ARLFYHKPQF AILDECTSAV SVDVEDYIYS HCRKVGITLF TVSHRKSLWK HHEYYLHMDG RGNYEFKKIT EDTVEFGS. It is sometimes possible for the material contained within the vial of "ATP-binding cassette sub-family D member 3 (Abcd3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.