Multidrug resistance protein 3 (ABCB4) Recombinant Protein | ABCB4 recombinant protein

Recombinant Human Multidrug resistance protein 3 (ABCB4) , partial

Cat. Num. AAA952304

• Gene Names: ABCB4; GBD1; ICP3; MDR2; MDR3; PGY3; ABC21; MDR2/3; PFIC-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Multidrug resistance protein 3 (ABCB4); Recombinant Human Multidrug resistance protein 3 (ABCB4); partial; ABCB4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 614-696; Partial
• Sequence: HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS
• Sequence Length: 696

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 4505771
• NCBI GeneID: 5244
• NCBI Accession #: NP_000434.1
• NCBI GenBank Nucleotide #: NM_000443.3
• UniProt Accession #: P21439; Q14813; A0A2V7; A4D1D3; A4D1D4; A4D1D5; D6W5P3; D6W5P4
• Molecular Weight: 135,259 Da
• NCBI Official Full Name: phosphatidylcholine translocator ABCB4 isoform A
• NCBI Official Synonym Full Names: ATP binding cassette subfamily B member 4
• NCBI Official Symbol: ABCB4
• NCBI Official Synonym Symbols: GBD1; ICP3; MDR2; MDR3; PGY3; ABC21; MDR2/3; PFIC-3
• NCBI Protein Information: phosphatidylcholine translocator ABCB4
• UniProt Protein Name: Phosphatidylcholine translocator ABCB4
• Protein Family: ABC transporter B family
• UniProt Gene Name: ABCB4

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function. [provided by RefSeq, Jul 2008]

Uniprot Description

Energy-dependent phospholipid efflux translocator that acts as a positive regulator of biliary lipid secretion. Functions as a floppase that translocates specifically phosphatidylcholine (PC) from the inner to the outer leaflet of the canalicular membrane bilayer into the canaliculi of hepatocytes. Translocation of PC makes the biliary phospholipids available for extraction into the canaliculi lumen by bile salt mixed micelles and therefore protects the biliary tree from the detergent activity of bile salts (PubMed:7957936, PubMed:8898203, PubMed:9366571, PubMed:17523162, PubMed:23468132, PubMed:24806754, PubMed:24723470, PubMed:24594635, PubMed:21820390). Plays a role in the recruitment of phosphatidylcholine (PC), phosphatidylethanolamine (PE) and sphingomyelin (SM) molecules to nonraft membranes and to fu rther enrichment of SM and cholesterol in raft membranes in hepatocytes (PubMed:23468132). Required for proper phospholipid bile formation (). Indirectly involved in cholesterol efflux activity from hepatocytes into the canalicular lumen in the presence of bile salts in an ATP-dependent manner (PubMed:24045840). Promotes biliary phospholipid secretion as canaliculi-containing vesicles from the canalicular plasma membrane (PubMed:9366571, PubMed:28012258). In cooperation with ATP8B1, functions to protect hepatocytes from the deleterious detergent activity of bile salts (PubMed:21820390). Does not confer multidrug resistance ().