Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-binding cassette sub-family B member 10 (Abcb10) Recombinant Protein | Abcb10 recombinant protein

Recombinant Mouse ATP-binding cassette sub-family B member 10, mitochondrial (Abcb10)

Gene Names
Abcb10; Abc-me; Abcb12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-binding cassette sub-family B member 10 (Abcb10); Recombinant Mouse ATP-binding cassette sub-family B member 10; mitochondrial (Abcb10); Abcb10 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
83-715aa; full length protein
Sequence
AGPRAAHPLFARLQGAAATGVRDLGNDSQRRPAATGRSEVWKLLGLVRPERGRLSAAVGF LAVSSVITMSAPFFLGRIIDVIYTNPSEGYGDSLTRLCAVLTCVFLCGAAANGIRVYLMQ SSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAG AQASVGVGMMFFVSPSLATFVLSVVPPISVLAVIYGRYLRKLSKATQDSLAEATQLAEER IGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEALARAGFFGAAGLSGNLIVLSVLYKG GLLMGSAHMTVGELSSFLMYAFWVGLSIGGLSSFYSELMKGLGAGGRLWELLERQPRLPF NEGMVLDEKTFQGALEFRNVHFTYPARPEVSVFQDFSLSIPSGSVTALVGPSGSGKSTVV SLLLRLYDPNSGTVSLDGHDIRQLNPVWLRSKIGTVSQEPVLFSCSVAENIAYGADNLSS VTAQQVERAAEVANAAEFIRSFPQGFDTVVGEKGILLSGGQKQRIAIARALLKNPKILLL DEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTIKNANFVAVLDHGKICEHGTHEE LLLKPNGLYRKLMNKQSFLSYNGAEQFLEPARA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abcb10 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,188 Da
NCBI Official Full Name
ATP-binding cassette sub-family B member 10, mitochondrial
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family B (MDR/TAP), member 10
NCBI Official Symbol
Abcb10
NCBI Official Synonym Symbols
Abc-me; Abcb12
NCBI Protein Information
ATP-binding cassette sub-family B member 10, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 10, mitochondrial
Protein Family
UniProt Gene Name
Abcb10
UniProt Synonym Gene Names
ABC-me protein; ABC transporter 10 protein
UniProt Entry Name
ABCBA_MOUSE

NCBI Description

This gene encodes a member of the ATP-binding cassette superfamily of transporters. ATP-binding cassette proteins transport various molecules across extra- and intra-cellular membranes. The encoded protein is localized to the mitochondrial inner membrane where it interacts with and stabilizes mitoferrin-1, and is important for heme biosynthesis. Additional evidence suggests the encoded protein is involved in oxidative stress protection and erythropoisesis. [provided by RefSeq, May 2013]

Uniprot Description

ABCB10: May mediate critical mitochondrial transport functions related to heme biosynthesis. Belongs to the ABC transporter superfamily. ABCB family. Mitochondrial peptide exporter (TC 3.A.1.212) subfamily.

Protein type: Transporter; Mitochondrial; Membrane protein, multi-pass; Transporter, ABC family; Membrane protein, integral; Hydrolase

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; nucleotide binding; protein binding; protein homodimerization activity; transporter activity

Biological Process: transmembrane transport; transport

Research Articles on Abcb10

Similar Products

Product Notes

The Abcb10 abcb10 (Catalog #AAA7007098) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 83-715aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abcb10 abcb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGPRAAHPLF ARLQGAAATG VRDLGNDSQR RPAATGRSEV WKLLGLVRPE RGRLSAAVGF LAVSSVITMS APFFLGRIID VIYTNPSEGY GDSLTRLCAV LTCVFLCGAA ANGIRVYLMQ SSGQSIVNRL RTSLFSSILR QEVAFFDKTR TGELINRLSS DTALLGRSVT ENLSDGLRAG AQASVGVGMM FFVSPSLATF VLSVVPPISV LAVIYGRYLR KLSKATQDSL AEATQLAEER IGNIRTIRAF GKEMTEVEKY TGRVDQLLQL AQKEALARAG FFGAAGLSGN LIVLSVLYKG GLLMGSAHMT VGELSSFLMY AFWVGLSIGG LSSFYSELMK GLGAGGRLWE LLERQPRLPF NEGMVLDEKT FQGALEFRNV HFTYPARPEV SVFQDFSLSI PSGSVTALVG PSGSGKSTVV SLLLRLYDPN SGTVSLDGHD IRQLNPVWLR SKIGTVSQEP VLFSCSVAEN IAYGADNLSS VTAQQVERAA EVANAAEFIR SFPQGFDTVV GEKGILLSGG QKQRIAIARA LLKNPKILLL DEATSALDAE NEHLVQEALD RLMEGRTVLI IAHRLSTIKN ANFVAVLDHG KICEHGTHEE LLLKPNGLYR KLMNKQSFLS YNGAEQFLEP ARA. It is sometimes possible for the material contained within the vial of "ATP-binding cassette sub-family B member 10 (Abcb10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.