Amino acid permease 8 (AAP8) Recombinant Protein | AAP8 recombinant protein
Recombinant Arabidopsis thaliana Amino acid permease 8 (AAP8), partial
Gene Names
AAP8; amino acid permease 8; ATAAP8; T27I1.3; T27I1_3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Amino acid permease 8 (AAP8); Recombinant Arabidopsis thaliana Amino acid permease 8 (AAP8); partial; AAP8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-475
Sequence
MDAYNNPSAVESGDAAVKSVDDDGREKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGTTVLVAFAIITYYTSTLLADCYRSPDSITGTRNYNYMGVVRSYLGGKKVQLCGVAQYVNLVGVTIGYTITASISLVAIGKSNCYHDKGHKAKCSVSNYPYMAAFGIVQIILSQLPNFHKLSFLSIIAAVMSFSYASIGIGLAIATVASGKIGKTELTGTVIGVDVTASEKVWKLFQAIGDIAFSYAFTTILIEIQDTLRSSPPENKVMKRASLVGVSTTTVFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLIDFANACIALHLIGAYQVYAQPFFQFVEENCNKKWPQSNFINKEYSSKVPLLGKCRVNLFRLVWRTCYVVLTTFVAMIFPFFNAILGLLGAFAFWPLTVYFPVAMHIAQAKVKKYSRRWLALNLLVLVCLIVSALAAVGSIIGLINSVKSYKPFKNLD
Sequence Length
475
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,815 Da
NCBI Official Full Name
amino acid permease 8
NCBI Official Symbol
AAP8
NCBI Official Synonym Symbols
amino acid permease 8; ATAAP8; T27I1.3; T27I1_3
NCBI Protein Information
amino acid permease 8
UniProt Protein Name
Amino acid permease 8
Protein Family
UniProt Gene Name
AAP8
NCBI Description
Encodes a high affinity amino acid transporter that is probably responsible for import of organic nitrogen into developing seeds. One of eight gene family members that encode amino acid permeases. Most closely related to AAP1 (75%) identity.
Uniprot Description
Amino acid-proton symporter. Stereospecific transporter with a broad specificity for glutamate, aspartate and neutral and acidic amino acids.
Research Articles on AAP8
Similar Products
Product Notes
The AAP8 aap8 (Catalog #AAA1231030) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-475. The amino acid sequence is listed below: MDAYNNPSAV ESGDAAVKSV DDDGREKRTG TFWTASAHII TAVIGSGVLS LAWAIAQLGW VAGTTVLVAF AIITYYTSTL LADCYRSPDS ITGTRNYNYM GVVRSYLGGK KVQLCGVAQY VNLVGVTIGY TITASISLVA IGKSNCYHDK GHKAKCSVSN YPYMAAFGIV QIILSQLPNF HKLSFLSIIA AVMSFSYASI GIGLAIATVA SGKIGKTELT GTVIGVDVTA SEKVWKLFQA IGDIAFSYAF TTILIEIQDT LRSSPPENKV MKRASLVGVS TTTVFYILCG CIGYAAFGNQ APGDFLTDFG FYEPYWLIDF ANACIALHLI GAYQVYAQPF FQFVEENCNK KWPQSNFINK EYSSKVPLLG KCRVNLFRLV WRTCYVVLTT FVAMIFPFFN AILGLLGAFA FWPLTVYFPV AMHIAQAKVK KYSRRWLALN LLVLVCLIVS ALAAVGSIIG LINSVKSYKP FKNLD. It is sometimes possible for the material contained within the vial of "Amino acid permease 8 (AAP8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
