ADP,ATP carrier protein 3, mitochondrial (AAC3) Recombinant Protein | AAC3 recombinant protein

Recombinant Arabidopsis thaliana ADP,ATP carrier protein 3, mitochondrial (AAC3)

• Gene Names: AAC3; ADP/ATP carrier 3; ATAAC3; F20O9.60; F20O9_60
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ADP; ATP carrier protein 3; mitochondrial (AAC3); Recombinant Arabidopsis thaliana ADP; Recombinant ADP; mitochondrial; ADP/ATP translocase 3 Adenine nucleotide translocator 3; ANT 3; AAC3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 70-379
• Sequence: APSEKTGTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGQRQFNGMVDVYKKTIASDGIVGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVLVDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGGG
• Sequence Length: 379

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 15235280
• NCBI GeneID: 828955
• NCBI Accession #: NP_194568.1
• NCBI GenBank Nucleotide #: NM_118980.3
• UniProt Accession #: O49447; Q8L9Y1; T04608
• Molecular Weight: 40,718 Da
• NCBI Official Full Name: ADP/ATP carrier 3 protein
• NCBI Official Symbol: AAC3
• NCBI Official Synonym Symbols: ADP/ATP carrier 3; ATAAC3; F20O9.60; F20O9_60
• NCBI Protein Information: ADP/ATP carrier 3 protein
• UniProt Protein Name: ADP,ATP carrier protein 3, mitochondrial
• Protein Family: WD repeat-containing protein
• UniProt Gene Name: AAC3
• UniProt Synonym Gene Names: ANT3; ANT 3
• UniProt Entry Name: ADT3_ARATH

NCBI Description

Encodes a mitochondrial ADP/ATP carrier protein. Shown in heterologous systems to be located in the plasma membrane. Has comparable affinity for ADP and ATP (in E.coli).

Uniprot Description

Function: Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane

By similarity.

Subunit structure: Homodimer

By similarity.

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.

Miscellaneous: The transmembrane helices are not perpendicular to the plane of the membrane, but cross the membrane at an angle. At least 2 of the odd-numbered transmembrane helices exhibit a sharp kink, due to the presence of a conserved proline residue

By similarity.

Sequence similarities: Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Contains 3 Solcar repeats.