Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Neurotrophin-4 Recombinant Protein | NTF4 recombinant protein

Recombinant Human Neurotrophin-4

Gene Names
NTF4; NT4; NT5; NT-4; NT-5; NTF5; GLC10; GLC1O; NT-4/5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurotrophin-4; Recombinant Human Neurotrophin-4; Neurotrophin-5; NT-5; Neutrophic factor 4; NTF4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
82-210aa; Full Length
Sequence
VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Sequence Length
210
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for NTF4 recombinant protein
Target-derived survival factor for peripheral sensory sympathetic neurons.
Product Categories/Family for NTF4 recombinant protein
References
Neurotrophin-5 a novel neurotrophic factor that activates trk and trkB.Berkemeier L.R., Winslow J.W., Kaplan D.R., Nikolics K., Goeddel D.V., Rosenthal A.Neuron 7:857-866(1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.9 kDa
NCBI Official Full Name
neurotrophin-4 preproprotein
NCBI Official Synonym Full Names
neurotrophin 4
NCBI Official Symbol
NTF4
NCBI Official Synonym Symbols
NT4; NT5; NT-4; NT-5; NTF5; GLC10; GLC1O; NT-4/5
NCBI Protein Information
neurotrophin-4
UniProt Protein Name
Neurotrophin-4
Protein Family
UniProt Gene Name
NTF4
UniProt Synonym Gene Names
NTF5; NT-4; NT-5
UniProt Entry Name
NTF4_HUMAN

NCBI Description

This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood. [provided by RefSeq, Jul 2008]

Uniprot Description

NT-4/5: Target-derived survival factor for peripheral sensory sympathetic neurons. Defects in NTF4 may be associated with susceptibility to primary open angle glaucoma type 1O (GLC1O). A form of primary open angle glaucoma (POAG). POAG is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place. Belongs to the NGF-beta family.

Protein type: Cell development/differentiation; Cytokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: cytoplasmic membrane-bound vesicle; endoplasmic reticulum lumen; extracellular region

Molecular Function: growth factor activity; neurotrophin p75 receptor binding; protein binding

Biological Process: adult locomotory behavior; cell-cell signaling; epidermis development; ganglion mother cell fate determination; long-term memory; mechanoreceptor differentiation; negative regulation of neuron apoptosis; neurite morphogenesis; regulation of neuron differentiation; sensory organ boundary specification; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Glaucoma 1, Open Angle, O

Research Articles on NTF4

Similar Products

Product Notes

The NTF4 ntf4 (Catalog #AAA969766) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 82-210aa; Full Length. The amino acid sequence is listed below: VSETAPASRR GELAVCDAVS GWVTDRRTAV DLRGREVEVL GEVPAAGGSP LRQYFFETRC KADNAEEGGP GAGGGGCRGV DRRHWVSECK AKQSYVRALT ADAQGRVGWR WIRIDTACVC TLLSRTGRA. It is sometimes possible for the material contained within the vial of "Neurotrophin-4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.