SDS-Page
Keratinocyte proline-rich Recombinant Protein | Lilrb3 recombinant protein
Recombinant Mouse Keratinocyte proline-rich protein
Gene Names
Pirb; Gp91; LIR-3; PIR-B; Lilrb3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratinocyte proline-rich; Recombinant Mouse Keratinocyte proline-rich protein; Cell-surface glycoprotein p91; Paired immunoglobulin-like receptor B; PIR-B; Lilrb3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
664-841
Sequence
RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ
Sequence Length
841
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for Lilrb3 recombinant protein
May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM)
Product Categories/Family for Lilrb3 recombinant protein
References
"Molecular cloning of a novel murine cell-surface glycoprotein homologous to killer cell inhibitory receptors."
Hayami K., Fukuta D., Nishikawa Y., Yamashita Y., Inui M., Ohyama Y., Hikida M., Ohmori H., Takai T.
J. Biol. Chem. 272:7320-7327(1997)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.57kD
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily B member 3
NCBI Official Synonym Full Names
paired Ig-like receptor B
NCBI Official Symbol
Pirb
NCBI Official Synonym Symbols
Gp91; LIR-3; PIR-B; Lilrb3
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily B member 3
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily B member 3
Protein Family
UniProt Gene Name
Lilrb3
UniProt Synonym Gene Names
Pirb; LIR-3; Leukocyte immunoglobulin-like receptor 3; PIR-B
UniProt Entry Name
LIRB3_MOUSE
Uniprot Description
Pirb: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B- cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Protein type: Membrane protein, integral
Biological Process: B cell homeostasis; B cell mediated immunity; cytokine and chemokine mediated signaling pathway; myeloid dendritic cell differentiation
Research Articles on Lilrb3
Similar Products
Product Notes
The Lilrb3 lilrb3 (Catalog #AAA969557) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 664-841. The amino acid sequence is listed below: RRRHRGKFRK DVQKEKDLQL SSGAEEPITR KGELQKRPNP AAATQEESLY ASVEDMQTED GVELNSWTPP EEDPQGETYA QVKPSRLRKA GHVSPSVMSR EQLNTEYEQA EEGQGANNQA AESGESQDVT YAQLCSRTLR QGAAASPLSQ AGEAPEEPSV YATLAAARPE AVPKDMEQ. It is sometimes possible for the material contained within the vial of "Keratinocyte proline-rich, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
