Regulator of chromosome condensation (RCC1) Recombinant Protein | RCC1 recombinant protein
Recombinant Human Regulator of chromosome condensation (RCC1)
Gene Names
RCC1; CHC1; RCC1-I; SNHG3-RCC1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regulator of chromosome condensation (RCC1); Recombinant Human Regulator of chromosome condensation (RCC1); RCC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-421, Full length protein
Sequence
SPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Sequence Length
420
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,146 Da
NCBI Official Full Name
regulator of chromosome condensation isoform a
NCBI Official Synonym Full Names
regulator of chromosome condensation 1
NCBI Official Symbol
RCC1
NCBI Official Synonym Symbols
CHC1; RCC1-I; SNHG3-RCC1
NCBI Protein Information
regulator of chromosome condensation
UniProt Protein Name
Regulator of chromosome condensation
Protein Family
UniProt Gene Name
RCC1
UniProt Synonym Gene Names
CHC1
Uniprot Description
Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis (PubMed:1944575, PubMed:17435751, PubMed:20668449, PubMed:22215983, PubMed:11336674). Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis (PubMed:12194828, PubMed:17435751, PubMed:22215983). Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import (PubMed:22215983). Involved in the regulation of onset of chromosome condensation in the S phase (PubMed:3678831). Binds both to the nucleosomes and double-stranded DNA (PubMed:17435751, PubMed:18762580).
Research Articles on RCC1
Similar Products
Product Notes
The RCC1 rcc1 (Catalog #AAA967078) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-421, Full length protein. The amino acid sequence is listed below: SPKRIAKRRS PPADAIPKSK KVKVSHRSHS TEPGLVLTLG QGDVGQLGLG ENVMERKKPA LVSIPEDVVQ AEAGGMHTVC LSKSGQVYSF GCNDEGALGR DTSVEGSEMV PGKVELQEKV VQVSAGDSHT AALTDDGRVF LWGSFRDNNG VIGLLEPMKK SMVPVQVQLD VPVVKVASGN DHLVMLTADG DLYTLGCGEQ GQLGRVPELF ANRGGRQGLE RLLVPKCVML KSRGSRGHVR FQDAFCGAYF TFAISHEGHV YGFGLSNYHQ LGTPGTESCF IPQNLTSFKN STKSWVGFSG GQHHTVCMDS EGKAYSLGRA EYGRLGLGEG AEEKSIPTLI SRLPAVSSVA CGASVGYAVT KDGRVFAWGM GTNYQLGTGQ DEDAWSPVEM MGKQLENRVV LSVSSGGQHT VLLVKDKEQS. It is sometimes possible for the material contained within the vial of "Regulator of chromosome condensation (RCC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
