Guanylyl cyclase-activating protein 1 (Guca1a) Recombinant Protein | Guca1a recombinant protein
Recombinant Mouse Guanylyl cyclase-activating protein 1 (Guca1a)
Gene Names
Guca1a; GC-A; Gcap1; Guca1; mGCAP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanylyl cyclase-activating protein 1 (Guca1a); Recombinant Mouse Guanylyl cyclase-activating protein 1 (Guca1a); Guca1a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-202, Full length protein
Sequence
GNIMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTINPWSDSSMSAEEFTDTVFAKIDINGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTGIVRRLQNGEHEEAGTGDLAAEAAG
Sequence Length
201
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Guca1a recombinant protein
This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. This protein, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,986 Da
NCBI Official Full Name
guanylyl cyclase-activating protein 1
NCBI Official Synonym Full Names
guanylate cyclase activator 1a (retina)
NCBI Official Symbol
Guca1a
NCBI Official Synonym Symbols
GC-A; Gcap1; Guca1; mGCAP1
NCBI Protein Information
guanylyl cyclase-activating protein 1
UniProt Protein Name
Guanylyl cyclase-activating protein 1
Protein Family
UniProt Gene Name
Guca1a
UniProt Synonym Gene Names
Gcap; Gcap1; Guca1; GCAP 1
NCBI Description
This gene encodes a calcium-binding photoreceptor protein. The encoded protein may be involved in modulation of guanylyl cyclase activity, and in turn, the mammalian cone phototransduction cascade. Disruption of this gene results in the retinal degeneration associated with cone dystrophy. [provided by RefSeq, Dec 2015]
Uniprot Description
Stimulates retinal guanylyl cyclase when free calcium ions concentration is low and inhibits guanylyl cyclase when free calcium ions concentration is elevated. This Ca2+-sensitive regulation of retinal guanylyl cyclase is a key event in recovery of the dark state of rod photoreceptors following light exposure.
Research Articles on Guca1a
Similar Products
Product Notes
The Guca1a guca1a (Catalog #AAA966984) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-202, Full length protein. The amino acid sequence is listed below: GNIMEGKSVE ELSSTECHQW YKKFMTECPS GQLTLYEFRQ FFGLKNLSPS ASQYVEQMFE TFDFNKDGYI DFMEYVAALS LVLKGKVEQK LRWYFKLYDV DGNGCIDRDE LLTIIRAIRT INPWSDSSMS AEEFTDTVFA KIDINGDGEL SLEEFMEGVQ KDQMLLDTLT RSLDLTGIVR RLQNGEHEEA GTGDLAAEAA G. It is sometimes possible for the material contained within the vial of "Guanylyl cyclase-activating protein 1 (Guca1a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
