Peripheral myelin protein 22 (Pmp22) Recombinant Protein | Pmp22 recombinant protein

Recombinant Rat Peripheral myelin protein 22 (Pmp22)

• Gene Names: Pmp22; Gas-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Peripheral myelin protein 22 (Pmp22); Recombinant Rat Peripheral myelin protein 22 (Pmp22); Recombinant Peripheral myelin protein 22 (Pmp22); Peripheral myelin protein 22; PMP-22; Protein CD25 SR13 myelin protein Schwann cell membrane glycoprotein; SAG; Pmp22 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-160
• Sequence: MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
• Sequence Length: 160

• Species: Rattus norvegicus (Rat)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 8393992
• NCBI GeneID: 24660
• NCBI Accession #: NP_058733.1
• NCBI GenBank Nucleotide #: NM_017037.1
• UniProt Accession #: P25094
• Molecular Weight: 17,946 Da
• NCBI Official Full Name: peripheral myelin protein 22
• NCBI Official Synonym Full Names: peripheral myelin protein 22
• NCBI Official Symbol: Pmp22
• NCBI Official Synonym Symbols: Gas-3
• NCBI Protein Information: peripheral myelin protein 22; SAG; PMP-22; SR13 myelin protein; schwann cell membrane glycoprotein
• UniProt Protein Name: Peripheral myelin protein 22
• Protein Family: Peripheral myelin protein
• UniProt Gene Name: Pmp22
• UniProt Synonym Gene Names: Cd25; Pmp-22; PMP-22; SAG
• UniProt Entry Name: PMP22_RAT

NCBI Description

mediates Schwann cell growth and peripheral myelin compaction; human homolog gene duplication causes Charcot-Marie-Tooth 1A (CMT1A) neuropathy [RGD, Feb 2006]

Uniprot Description

Function: Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas). Ref.4

Developmental stage: Levels increase between embryonic day 21 (E21) and postnatal day 0 (PND0) and then gradually increase up to PND15. There is a slight increase between PND15 and adulthood. Ref.4

Induction: Strongly down-regulated in the initial phase after sciatic nerve injury.

Sequence similarities: Belongs to the PMP-22/EMP/MP20 family.