Acetylcholine receptor subunit alpha (Chrna1) Recombinant Protein | Chrna1 recombinant protein

Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial

Cat. Num. AAA966167

• Gene Names: Chrna1; Acra; Achr-1; AI385656; AI608266
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Acetylcholine receptor subunit alpha (Chrna1); Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1); partial; Chrna1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-230aa; Partial
• Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for Chrna1 recombinant protein

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

References

Nucleotide sequence of the mouse muscle nicotinic acetylcholine receptor alpha subunit.Isenberg K.E., Mudd J., Shah V., Merlie J.P.Nucleic Acids Res. 14:5111-5111(1986) Boulter J. Isolation of a clone coding for the alpha-subunit of a mouse acetylcholine receptor.Boulter J., Luyten W., Evans K., Mason P., Ballivet M., Goldman D.J., Stengelin S.F., Martin G., Heinemann S.F., Patrick J.J. Neurosci. 5:2545-2552(1985) Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.Dellisanti C.D., Yao Y., Stroud J.C., Wang Z.Z., Chen L.Nat. Neurosci. 10:953-962(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 31542391
• NCBI GeneID: 11435
• NCBI Accession #: NP_031415.2
• NCBI GenBank Nucleotide #: NM_007389.5
• UniProt Accession #: P04756
• Molecular Weight: 26.5 kDa
• NCBI Official Full Name: acetylcholine receptor subunit alpha
• NCBI Official Synonym Full Names: cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)
• NCBI Official Symbol: Chrna1
• NCBI Official Synonym Symbols: Acra; Achr-1; AI385656; AI608266
• NCBI Protein Information: acetylcholine receptor subunit alpha
• UniProt Protein Name: Acetylcholine receptor subunit alpha
• Protein Family: Acetylcholine receptor
• UniProt Gene Name: Chrna1
• UniProt Synonym Gene Names: Acra
• UniProt Entry Name: ACHA_MOUSE

NCBI Description

This gene encodes an alpha subunit of the muscle-derived nicotinic acetylcholine receptor, a pentameric neurotransmitter receptor and member of the ligand-gated ion channel superfamily. The alpha subunit plays a role in substrate binding and channel gating. [provided by RefSeq, Nov 2012]

Uniprot Description

nAChRA1: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in CHRNA1 are a cause of multiple pterygium syndrome lethal type (MUPSL). Multiple pterygia are found infrequently in children with arthrogryposis and in fetuses with fetal akinesia syndrome. In lethal multiple pterygium syndrome there is intrauterine growth retardation, multiple pterygia, and flexion contractures causing severe arthrogryposis and fetal akinesia. Subcutaneous edema can be severe, causing fetal hydrops with cystic hygroma and lung hypoplasia. Oligohydramnios and facial anomalies are frequent. The alpha subunit is the main focus for antibody binding in myasthenia gravis. Myasthenia gravis is characterized by sporadic muscular fatigability and weakness, occurring chiefly in muscles innervated by cranial nerves, and characteristically improved by cholinesterase-inhibiting drugs. Defects in CHRNA1 are a cause of congenital myasthenic syndrome slow-channel type (SCCMS). SCCMS is the most common congenital myasthenic syndrome. Congenital myasthenic syndromes are characterized by muscle weakness affecting the axial and limb muscles (with hypotonia in early-onset forms), the ocular muscles (leading to ptosis and ophthalmoplegia), and the facial and bulbar musculature (affecting sucking and swallowing, and leading to dysphonia). The symptoms fluctuate and worsen with physical effort. SCCMS is caused by kinetic abnormalities of the AChR, resulting in prolonged endplate currents and prolonged AChR channel opening episodes. Defects in CHRNA1 are a cause of congenital myasthenic syndrome fast-channel type (FCCMS). FCCMS is a congenital myasthenic syndrome characterized by kinetic abnormalities of the AChR. In most cases, FCCMS is due to mutations that decrease activity of the AChR by slowing the rate of opening of the receptor channel, speeding the rate of closure of the channel, or decreasing the number of openings of the channel during ACh occupancy. The result is failure to achieve threshold depolarization of the endplate and consequent failure to fire an action potential. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 1/CHRNA1 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Channel, ligand-gated; Membrane protein, multi-pass; Receptor, misc.

Cellular Component: cell junction; cell surface; integral to membrane; membrane; neuromuscular junction; nicotinic acetylcholine-gated receptor-channel complex; plasma membrane; postsynaptic membrane; synapse

Molecular Function: acetylcholine binding; acetylcholine receptor activity; extracellular ligand-gated ion channel activity; ion channel activity; nicotinic acetylcholine-activated cation-selective channel activity; protein binding

Biological Process: cation transport; generation of action potential; ion transport; muscle maintenance; musculoskeletal movement; neuromuscular junction development; neuromuscular process; neuromuscular synaptic transmission; regulation of membrane potential; response to nicotine; skeletal muscle contraction; skeletal muscle growth; synaptic transmission, cholinergic; transport