POU domain, class 3, transcription factor 1 (Pou3f1) Recombinant Protein | Pou3f1 recombinant protein
Recombinant Mouse POU domain, class 3, transcription factor 1 (Pou3f1)
Gene Names
Pou3f1; Oct6; Otf6; Scip; Tst1; Oct-6; Otf-6; Test1; Tst-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
POU domain; class 3; transcription factor 1 (Pou3f1); Recombinant Mouse POU domain; Pou3f1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-449, Full length protein
Sequence
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGSASPPSAPPPPPPAALHHHHHHTLPGSVQ
Sequence Length
449
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,324 Da
NCBI Official Full Name
POU domain, class 3, transcription factor 1
NCBI Official Synonym Full Names
POU domain, class 3, transcription factor 1
NCBI Official Symbol
Pou3f1
NCBI Official Synonym Symbols
Oct6; Otf6; Scip; Tst1; Oct-6; Otf-6; Test1; Tst-1
NCBI Protein Information
POU domain, class 3, transcription factor 1
UniProt Protein Name
POU domain, class 3, transcription factor 1
Protein Family
UniProt Gene Name
Pou3f1
UniProt Synonym Gene Names
Oct6; Otf-6; Otf6; Scip; Oct-6; OTF-6
Uniprot Description
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Thought to be involved in early embryogenesis and neurogenesis.
Research Articles on Pou3f1
Similar Products
Product Notes
The Pou3f1 pou3f1 (Catalog #AAA965394) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-449, Full length protein. The amino acid sequence is listed below: MATTAQYLPR GPGGGAGGTG PLMHPDAAAA AAAAAERLHA GAAYREVQKL MHHEWLGAGA GHPVGLAHPQ WLPTGGGGGG DWAGGPHLEH GKAGGGGTGR ADDGGGGGGF HARLVHQGAA HAGAAWAQGG TAHHLGPAMS PSPGAGGGHQ PQPLGLYAQA AYPGGGGGGL AGMLAAGGGG AGPGLHHALH EDGHEAQLEP SPPPHLGAHG HAHGHAHAGG LHAAAAHLHP GAGGGGSSVG EHSDEDAPSS DDLEQFAKQF KQRRIKLGFT QADVGLALGT LYGNVFSQTT ICRFEALQLS FKNMCKLKPL LNKWLEETDS SSGSPTNLDK IAAQGRKRKK RTSIEVGVKG ALESHFLKCP KPSAHEITGL ADSLQLEKEV VRVWFCNRRQ KEKRMTPAAG AGHPPMDDVY APGELGPGGG SASPPSAPPP PPPAALHHHH HHTLPGSVQ. It is sometimes possible for the material contained within the vial of "POU domain, class 3, transcription factor 1 (Pou3f1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
