Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome b-c1 complex subunit 7 (UQCRB) Recombinant Protein | UQCRB recombinant protein

Recombinant Human Cytochrome b-c1 complex subunit 7 (UQCRB)

Gene Names
UQCRB; QPC; QCR7; QP-C; UQBC; UQBP; UQPC; UQCR6; MC3DN3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b-c1 complex subunit 7 (UQCRB); Recombinant Human Cytochrome b-c1 complex subunit 7 (UQCRB); UQCRB recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-111, Full length protein
Sequence
AGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Sequence Length
110
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for UQCRB recombinant protein
This gene encodes a protein which is part of the ubiquinol-cytochrome c oxidoreductase complex which contains ten nuclear-encoded and one mitochondrial-encoded subunits. The encoded protein binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. Mutations in this gene are associated with mitochondrial complex III deficiency. A pseudogene has been described on the X chromosome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,267 Da
NCBI Official Full Name
cytochrome b-c1 complex subunit 7 isoform 2
NCBI Official Synonym Full Names
ubiquinol-cytochrome c reductase binding protein
NCBI Official Symbol
UQCRB
NCBI Official Synonym Symbols
QPC; QCR7; QP-C; UQBC; UQBP; UQPC; UQCR6; MC3DN3
NCBI Protein Information
cytochrome b-c1 complex subunit 7
UniProt Protein Name
Cytochrome b-c1 complex subunit 7
Protein Family
UniProt Gene Name
UQCRB
UniProt Synonym Gene Names
UQBP

NCBI Description

This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. This protein plays an important role in hypoxia-induced angiogenesis through mitochondrial reactive oxygen species-mediated signaling. Mutations in this gene are associated with mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. Related pseudogenes have been identified on chromosomes 1, 5 and X. [provided by RefSeq, Dec 2011]

Uniprot Description

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.

Research Articles on UQCRB

Similar Products

Product Notes

The UQCRB uqcrb (Catalog #AAA965376) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-111, Full length protein. The amino acid sequence is listed below: AGKQAVSASG KWLDGIRKWY YNAAGFNKLG LMRDDTIYED EDVKEAIRRL PENLYNDRMF RIKRALDLNL KHQILPKEQW TKYEEENFYL EPYLKEVIRE RKEREEWAKK. It is sometimes possible for the material contained within the vial of "Cytochrome b-c1 complex subunit 7 (UQCRB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.