Interleukin-3 Recombinant Protein | IL3 recombinant protein

Recombinant Human Interleukin-3

Cat. Num. AAA965287

• Gene Names: IL3; IL-3; MCGF; MULTI-CSF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-3; Recombinant Human Interleukin-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-152aa; Full Length
• Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Sequence Length: 152

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IL3 recombinant protein

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hatopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, st cells, erythroid cells, eosinophils and megakaryocytes.

Product Categories/Family for IL3 recombinant protein

Immunology

References

Characterization of a human multilineage-colony-stimulating factor cDNA clone identified by a conserved noncoding sequence in mouse interleukin-3.Dorssers L., Burger H., Bot F., Delwel R., Geurts van Kessel A.H.M., Loewenberg B., Wagemaker G.Gene 55:115-124(1987) Isolation and characterization of an expressible cDNA encoding human IL-3. Induction of IL-3 mRNA in human T cell clones.Otsuka T., Miyajima A., Brown N., Otsu K., Abrams J., Saeland S., Caux C., de Waal Malefijt R., de Vries J., Meyerson P., Yokota K., Gemmel L., Rennick D., Lee F., Arai N., Arai K., Yokota T.J. Immunol. 140:2288-2295(1988) Human IL-3 (multi-CSF) identification by expression cloning of a novel hematopoietic growth factor related to murine IL-3.Yang Y.-C., Ciarletta A.B., Temple P.A., Chung M.P., Kovacic S., Witek-Giannotti J.S., Leary A.C., Kriz R., Donahue R.E., Wong G.G., Clark S.C.Cell 47:3-10(1986) SeattleSNPs variation discovery resourceThe DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004) Molecular characterization of colony-stimulating factors and their receptors human interleukin-3.Urdal D.L., Price V., Sassenfeld H.M., Cosman D., Gillis S., Park L.S.Ann. N. Y. Acad. Sci. 554:167-176(1989) Three-dimensional solution structure and backbone dynamics of a variant of human interleukin-3.Feng Y., Klein B.K., McWherter C.A.J. Mol. Biol. 259:524-541(1996)

NCBI and Uniprot Product Information

• NCBI GI #: 28416915
• NCBI GeneID: 3562
• NCBI Accession #: NP_000579.2
• NCBI GenBank Nucleotide #: NM_000588.3
• UniProt Accession #: P08700; Q6GS87
• Molecular Weight: 42.1 kDa
• NCBI Official Full Name: interleukin-3
• NCBI Official Synonym Full Names: interleukin 3
• NCBI Official Symbol: IL3
• NCBI Official Synonym Symbols: IL-3; MCGF; MULTI-CSF
• NCBI Protein Information: interleukin-3
• UniProt Protein Name: Interleukin-3
• Protein Family: Interleukin
• UniProt Gene Name: IL3
• UniProt Synonym Gene Names: IL-3; MCGF
• UniProt Entry Name: IL3_HUMAN

NCBI Description

The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]

Uniprot Description

IL3: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Belongs to the IL-3 family.

Protein type: Apoptosis; Cell cycle regulation; Cytokine; Oncoprotein; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular region; extracellular space

Molecular Function: cytokine activity; interleukin-3 receptor binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity

Biological Process: cell-cell signaling; cytokine and chemokine mediated signaling pathway; embryonic hemopoiesis; MAPKKK cascade; nervous system development; positive regulation of cell proliferation; positive regulation of DNA replication; positive regulation of myeloid leukocyte differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of tyrosine phosphorylation of Stat5 protein