Troponin I, fast skeletal muscle (TNNI2) Recombinant Protein | TNNI2 recombinant protein
Recombinant Chicken Troponin I, fast skeletal muscle (TNNI2)
Gene Names
TNNI2; TNI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Troponin I; fast skeletal muscle (TNNI2); Recombinant Chicken Troponin I; Recombinant Troponin I; fast skeletal muscle; fast-twitch isoform; TNNI2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-183aa; Full length protein
Sequence
SDEEKKRRAATARRQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEHCPPLSLPGSMQEL QELCKKLHAKIDSVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLRRVRMSADA MLRALLGSKHKVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAG ES
Sequence Length
183
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for TNNI2 recombinant protein
This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,234 Da
NCBI Official Full Name
troponin I, fast skeletal muscle
NCBI Official Synonym Full Names
troponin I type 2 (skeletal, fast)
NCBI Official Symbol
TNNI2
NCBI Official Synonym Symbols
TNI
NCBI Protein Information
troponin I, fast skeletal muscle; sTnI protein (aa 85-182); troponin I, skeletal, fast; troponin I, fast-twitch isoform
UniProt Protein Name
Troponin I, fast skeletal muscle
Protein Family
UniProt Gene Name
TNNI2
UniProt Entry Name
TNNI2_CHICK
Uniprot Description
Function: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Subunit structure: Binds to actin and tropomyosin.
Post-translational modification: The N-terminus is blocked.
Sequence similarities: Belongs to the troponin I family.
Research Articles on TNNI2
Similar Products
Product Notes
The TNNI2 tnni2 (Catalog #AAA964421) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-183aa; Full length protein. The amino acid sequence is listed below: SDEEKKRRAA TARRQHLKSA MLQLAVTEIE KEAAAKEVEK QNYLAEHCPP LSLPGSMQEL QELCKKLHAK IDSVDEERYD TEVKLQKTNK ELEDLSQKLF DLRGKFKRPP LRRVRMSADA MLRALLGSKH KVNMDLRANL KQVKKEDTEK EKDLRDVGDW RKNIEEKSGM EGRKKMFEAG ES. It is sometimes possible for the material contained within the vial of "Troponin I, fast skeletal muscle (TNNI2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
