Adenosine receptor A2a (ADORA2A) Recombinant Protein | Adora2a recombinant protein
Recombinant Guinea pig Adenosine receptor A2a (ADORA2A)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenosine receptor A2a (ADORA2A); Recombinant Guinea pig Adenosine receptor A2a (ADORA2A); Recombinant Adenosine receptor A2a (ADORA2A); Adenosine receptor A2a; Adora2a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-409
Sequence
MSSSVYITVELVIAVLAILGNVLVCWAVWINSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFFACFVLVLTQSSIFSLLTITIDRYIAIRIPLRYNGLVTCTRAKGIIAICWVLSFAIGLTPMLGWNNCSQPKGDKNHSESCDEGQVTCLFEDVVPMNYMVYYNFFAFVLVPLLLMLGIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHPAKSLAIIVGLFALCCLPLNIINCFTFFCPECDHAPPWLMYLTIILSHGNSVVNPLIYAYRIREFRQTFRKIIRSHILRRRELFKAGGTSARASAAHSPEGEQVSLRLNGHPPGVWANGSALRPEQRPNGYVLGLVSGRSAQRSHGDASLSDVELLSHEHKGTCPESPSLEDPPAHGGAGVS
Sequence Length
409
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,943 Da
NCBI Official Full Name
adenosine receptor A2a
NCBI Official Symbol
Adora2a
NCBI Protein Information
adenosine receptor A2a
UniProt Protein Name
Adenosine receptor A2a
Protein Family
UniProt Gene Name
ADORA2A
UniProt Entry Name
AA2AR_CAVPO
Uniprot Description
Function: Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subunit structure: Interacts (via cytoplasmic C-terminal domain) with USP4; the interaction is direct
By similarity. May interact with DRD4
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Domain: The cytoplasmic C-terminal domain is necessary for targeting the non-ubiquitinated form of this protein to the cell surface
By similarity.
Post-translational modification: Ubiquitinated. Deubiquitinated by USP4; leading to stabilization and expression at the cell surface
By similarity.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The Adora2a adora2a (Catalog #AAA964149) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-409. The amino acid sequence is listed below: MSSSVYITVE LVIAVLAILG NVLVCWAVWI NSNLQNVTNY FVVSLAAADI AVGVLAIPFA ITISTGFCAA CHGCLFFACF VLVLTQSSIF SLLTITIDRY IAIRIPLRYN GLVTCTRAKG IIAICWVLSF AIGLTPMLGW NNCSQPKGDK NHSESCDEGQ VTCLFEDVVP MNYMVYYNFF AFVLVPLLLM LGIYLRIFLA ARRQLKQMES QPLPGERTRS TLQKEVHPAK SLAIIVGLFA LCCLPLNIIN CFTFFCPECD HAPPWLMYLT IILSHGNSVV NPLIYAYRIR EFRQTFRKII RSHILRRREL FKAGGTSARA SAAHSPEGEQ VSLRLNGHPP GVWANGSALR PEQRPNGYVL GLVSGRSAQR SHGDASLSDV ELLSHEHKGT CPESPSLEDP PAHGGAGVS. It is sometimes possible for the material contained within the vial of "Adenosine receptor A2a (ADORA2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
