G1/S-specific cyclin-D2 (Ccnd2) Recombinant Protein | Ccnd2 recombinant protein

Recombinant Rat G1/S-specific cyclin-D2 (Ccnd2)

Cat. Num. AAA963271

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: G1/S-specific cyclin-D2 (Ccnd2); Recombinant Rat G1/S-specific cyclin-D2 (Ccnd2); Ccnd2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-288, Full length protein
• Sequence: MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVNALTCDALTELLTKITHTDVDCLKACQEQIEAVLLNSLQQFRQEQHNGSKSVEDPDQATTPTDVRDVDL
• Sequence Length: 288

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Ccnd2 recombinant protein

This protein belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1
S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors.

NCBI and Uniprot Product Information

• NCBI GI #: 57900652
• NCBI GeneID: 64033
• NCBI Accession #: NP_071603.1
• NCBI GenBank Nucleotide #: NM_022267.1
• UniProt Accession #: Q04827
• Molecular Weight: 32,826 Da
• NCBI Official Full Name: G1/S-specific cyclin-D2
• NCBI Official Synonym Full Names: cyclin D2
• NCBI Official Symbol: Ccnd2
• NCBI Protein Information: G1/S-specific cyclin-D2
• UniProt Protein Name: G1/S-specific cyclin-D2
• Protein Family: G1/S-specific cyclin
• UniProt Gene Name: Ccnd2
• UniProt Synonym Gene Names: Vin-1

NCBI Description

plays a role in the G1 to S phase transition; involved in regulation of cell proliferation [RGD, Feb 2006]

Uniprot Description

Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G1/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G1 phase. Hypophosphorylates RB1 in early G1 phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex ().